Detailed information on CNT30140879


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 4e-102

BLAST vs NONCODE:
NONMEST001181, E-value = 6e-90

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30140879

Peptides detected in this lncRNA

>peptide 1 (54 aa)
TQQNLKLSSGFTYSFITVQFIATAPRQMFVDKYDITLDNKTAGKEDNRPLDQNN*

>peptide 2 (53 aa)
MPSLSWIFAFTLSMVSDDSTSRVMVLPVRVLTKICIPPRRRSTRWRVDSFWML*

>peptide 3 (32 aa)
TTEFETKFRVHLFIHHGSIHSYCTTADVCRQI*

>peptide 4 (42 aa)
MRRCWSGGMPSLSWIFALTLSMVSEDSTSRVMVLPVRVLTKIC

Sequence

>CNT30140879
ACACAACAGAATTTGAAACTAAGTTCAGGGTTCACTTATTCATTCATCACGGTTCAATTCATAGCTACTGCACCACGGCAGATGTTTGTAGACAAATATG
ATATCACACTAGACAACAAAACGGCAGGAAAAGAAGATAATCGACCACTCGACCAGAACAACTGACATCCCCAGTGGAGGACACCGAAGACCCCACAGTT
GAGAACCCTCAGAGATTGAATCAGCTCCTTACTGGCCACCACGGAGGCGGAGCACCAAGTGAAGGGTGGACTCCTTCTGGATGTTGTAGTCCGCCAGGGT
GCGGCCATCCTCCAGCTGCTTACCAGCAAAGATCAGACGCTGCTGGTCTGGGGGGATGCCCTCCTTGTCCTGGATCTTCGCCTTCACGTTGTCGATGGTG
TCTGACGACTCCACCTCGAGGGTGATGGTCTTGCCAGTGAGGGTCTTGACAAAGATCTGCATACCACCACGGAGGCGGAGCACCAGGTGGAGGGTGGACT
CCTTCTGGATGTTGTAGTCTGCCAGGGTGCGGCCATCCTCCAGCTGCTTGCCAGCGAAGATGAGGCGCTGCTGGTCCGGAGGGATGCCCTCCTTGTCCTG
GATCTTCGCCTTGACGTTGTCGATGGTGTCCGAGGACTCCACCTCGAGGGTGATGGTCTTGCCGGTGAGGGTCTTGACGAAGATCTGCAT