Detailed information on CNT3014085


BLAST search results

BLAST vs Swiss-Prot:
sp|O23755|EF2_BETVU, E-value = 1e-94

BLAST vs NONCODE:
NONGMAT000778, E-value = 6e-31

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674834Zea maysSetaria viridis29.6728.2493.92181forward
CNT30532843Zea maysEucalyptus grandis33.7728.1488.35206forward
CNT30316236Zea maysCorylus avellana39.0251.8585.71238forward
CNT30547574Zea maysIpomoea triloba25.5743.9487.82156forward
CNT30512729Zea maysJuglans regia49.5129.3584.77302forward
CNT30371838Zea maysArabidopsis thaliana41.4819.1882.61253forward
CNT30276060Zea maysChenopodium quinoa38.6937.2284.75236forward
CNT30379936Zea maysManihot esculenta37.5468.5686.46229forward
CNT30488117Zea maysOlea europaea28.8536.0785.8176forward
CNT30711584Zea maysGlycine max90.8278.6981.95554forward
CNT3045373Zea maysPrunus dulcis36.2328.1985.52221forward
CNT30191304Zea maysSecale cereale51.6424.2190.48315forward
CNT30300473Zea maysTriticum aestivum51.6432.5489.52315forward
CNT30224354Zea maysHordeum vulgare51.6460.6990.16315forward
CNT30395070Zea maysTriticum turgidum51.6441.1887.62315forward
CNT30561656Zea maysActinidia chinensis47.2120.5783.33288forward
CNT3085191Zea maysVigna radiata39.6733.7583.47242forward
CNT30510505Zea maysSolanum lycopersicum44.5925.0587.87272forward
CNT30552635Zea maysOryza glaberrima91.4853.7688.17558forward
CNT30143941Zea maysMedicago truncatula39.6754.0283.47242forward
CNT30440797Zea maysAegilops tauschii92.4677.4786.52564forward
CNT30313757Zea maysCamelina sativa42.1329.383.27257forward
CNT30135610Zea maysLolium perenne31.9723.0590.77195forward
CNT30605685Zea maysGossypium raimondii50.9840.7185.21311forward
CNT30683923Zea maysTriticum urartu51.6434.4387.62315forward
CNT30722731Zea maysTriticum spelta35.5742.4783.41217forward
CNT30361520Zea maysSorghum bicolor40.3335.9695.12246forward
CNT30596064Zea maysOryza meridionalis59.1870.5187.26361forward
CNT30359537Zea maysLactuca sativa2018.5183.61122forward
CNT30369654Zea maysOryza glumipatula48.233.4189.46294forward
CNT30107537Zea maysOryza longistaminata91.4860.7287.46558forward
CNT30100253Zea maysOryza rufipogon91.4850.6488.17558forward
CNT30575129Zea maysOryza barthii91.4868.5588.17558forward
CNT30497701Zea maysDigitaria exilis42.379.3893.41258forward
CNT30116094Zea maysOryza nivara91.4863.4188.17558forward
CNT30604019Zea maysOryza punctata54.197.6389.09330forward

Expression of CNT3014085

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MFSSASAPSFDAHWKPATTESLISLRYCTPLHISTTMFGPVVSGPKHQIFLARSL

>peptide 2 (67 aa)
MKNDITDLEANPAHVLFSQCTLLRCPLETSHNRILDFIEILHSLAHINNHVWAGGLRSEAPNLLGKIL

>peptide 3 (86 aa)
PRLRVTIKTSNSSKNEKIRACPQTQKEESSVLSDPSSCGYPAPAGQPGSQPPKDPSPSCPSGQTHTGGTPDQRLQPSAGLRTQRTR*

Sequence

>CNT3014085
CCCAGACTCCGAGTGACAATTAAAACCAGTAACAGTAGCAAAAACGAAAAGATTAGAGCTTGTCCTCAAACTCAGAAAGAGGAGTCATCTGTTCTTTCAG
ACCCTTCCTCTTGCGGATATCCAGCACCAGCTGGGCAGCCTGGGAGCCAGCCTCCAAAGGATCCGAGCCCATCATGTCCCAGTGGTCAAACACACACTGG
GGGAACGCCTGACCAGAGGTTGCAGCCCTCAGCTGGCTTGAGAACCCAAAGGACTCGATGACAGGGAGGAAAGCCTTGATGTTGTAGAGCGGGGTACCAG
GTAAACTGGTTCCAGCAGCCTCGGCTTGGCTGTGAGCTGAGAAGCATAAATGACCCTCCTGGCAGTTGGAATGACCTGGCCACCACCCCTGTGGATAGCA
TCGGCATGAAGAACGACATCACAGACCTCGAAGCAAATCCCGCGCATGTTCTCTTCAGCCAGTGCACCCTCCTTCGATGCCCACTGGAAACCAGCCACAA
CAGAATCCTTGATTTCATTGAGATACTGCACTCCCTTGCACATATCAACAACCATGTTTGGGCCGGTGGTCTCAGGTCCGAAGCACCAAATCTTCTTGGC
AAGATCCTTG