Detailed information on CNT30139725


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30225986Lolium perenneHordeum vulgare80.1647.0995.061317forward
CNT30257693Lolium perenneAvena sativa69.299.8298.771137reverse complement

Expression of CNT30139725

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MMLSHANVSRAMACFEHSNFFKVTMPVARPGQLRLGAHRRLKGRVGRCSP*

>peptide 2 (48 aa)
PRNPKTLISHKVPAESYKQHPPIPGRHRLWLRLGRYLIVFEPPTFVLD*

>peptide 3 (55 aa)
MRPSQKSGFVARISSRITTVIRVARTIKQTITDLMSHSQFHSSNWFILAHAWLNL*

>peptide 4 (30 aa)
MMRRRHEGLAIRRVIMNHRISGQSPRQPFI*

>peptide 5 (32 aa)
MKYECPRLSLLIITPIPKANTIGPESYDVIPC*

>peptide 6 (41 aa)
MRPVLLFIVTTSPCQDWVICAPAAFLGCGSRFSGSLSGIEP*

>peptide 7 (44 aa)
MLSQLFVFHKSKNFTSDYEIRMPPTVPINHYSDPEGQHNRTGIL*

Sequence

>CNT30139725
CCCCCGGAACCCAAAGACTTTGATTTCTCATAAGGTGCCGGCGGAGTCCTATAAGCAACATCCGCCGATCCCTGGTCGGCATCGTTTATGGTTGAGACTA
GGACGGTATCTGATCGTCTTCGAGCCCCCAACTTTCGTTCTTGATTAATGAAAACATCCTTGGCAAATGCTTTCGCAGTTGTTCGTCTTTCATAAATCCA
AGAATTTCACCTCAGACTATGAAATACGAATGCCCCCGACTGTCCCTATTAATCATTACTCCGATCCCGAAGGCCAACACAATAGGACCGGAATCCTATG
ATGTTATCCCATGCTAATGTATCCAGAGCGATGGCTTGCTTTGAGCACTCTAATTTCTTCAAAGTAACGATGCCGGTGGCACGACCCGGCCAATTAAGGC
TAGGAGCGCATCGCCGGCTGAAGGGTCGAGTTGGTCGGTGCTCGCCGTGAGGCGGACCGGCCGACCCGGCCCAAAGTCCAACTACGAGCTTTTTAACTGC
AACAACTTAAATATACGCTATTGGAGCTGGAATTACCGCGGCTGCTGGCACCAGACTTGCCCTCCAATGGATCCTCGTTAAGGGATTTAGATTGTACTCA
TTCCAATTACCAGACACTAATGCGCCCGGTATTGTTATTTATTGTCACTACCTCCCCGTGTCAGGATTGGGTAATTTGCGCGCCTGCTGCCTTCCTTGGA
TGTGGTAGCCGTTTCTCAGGCTCCCTCTCCGGAATCGAACCCTAATTCTCCGTCACCCGTCACCACCATGGTAGGCCCCTATCCTACCATCGAAAGTTGA
TAGGGCAGAAATTTGAATGATGCGTCGCCGGCACGAGGGCCTTGCGATCCGTCGAGTTATCATGAATCATCGGATCAGCGGGCAGAGCCCGCGTCAGCCT
TTTATCTAATAAATGCGCCCCTCCCAGAAGTCGGGGTTTGTTGCACGTATTAGCTCTAGAATTACTACGGTTATCCGAGTAGCACGTACCATCAAACAAA
CTATAACTGATTTAATGAGCCATTCGCAGTTTCACAGTTCAAATTGGTTCATACTTGCACATGCATGGCTTAATCTTTGAGACAAGCATATGACTACTGG
CAGGATCAACCAGGTAGCACGTCCTCGTTGACGTCCAGCGTCGGTCTTTGTCCGCCCTTCCACTTGCGTGTCAAGGCCGAGGCAACGGCCGAGCCGGTTG
TCGCGATTGAGCGGGCCAAGCTCATCCTACTTGATTGAGGATCGGCGCAGAATGTTACGTATCCTACCACTAACTGTGGAGAGGTAGAGGCAACACCTGT
TCACGGTTGTTCTCAAATTCGGAGAGCAGCTTAAGGGTCAGGTCCTAGCAACCAAAAGGTTGCCAAGACTCTTTATCGTGAGCAACATCCGAGACCAACA
GCAGGAGCAAGGCTGCCTTGGTAGCACCGGGCACTAGGAGTGCCGGAACCACGAGGAAACGCCGCAAGCGCCGTTAGGCCGCAGCGGCACACCCGAAGGT
GTCCACCGCGAGGCAAACGTGTTAGAAGCACCACTTCCCGTAGGTCGGGTACCAGCACGCAAGCACTTGAAAGGCGACATCATCATATAAGCCAAACGAA
CGACGGGACACGGCGCCTGTAGTCGGCCGCACGAAGACGGGGG