Detailed information on CNT30139418


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694665Lolium perenneOryza sativa16.151.4383.89180forward
CNT30670880Lolium perenneSetaria viridis5.8130.3710065forward
CNT30617758Lolium perenneSesamum indicum5.0124.3591.0756forward
CNT30302408Lolium perenneTriticum aestivum43.2965.1490.29484forward
CNT30225510Lolium perenneHordeum vulgare10.0237.5894.64112forward
CNT30395404Lolium perenneTriticum turgidum18.3457.4294.15205forward
CNT30589659Lolium perenneMusa acuminata6.8926.7487.0177forward
CNT30552718Lolium perenneOryza glaberrima26.4833.1886.15296forward
CNT30442203Lolium perenneAegilops tauschii44.0144.6989.23492forward
CNT30254552Lolium perenneAvena sativa15.1237.8993.49169forward
CNT30666984Lolium perenneTriticum dicoccoides44.0150.6789.84492forward
CNT3075396Lolium perenneBrassica juncea8.5921.0586.4696forward
CNT309611Lolium perenneZea mays15.1242.7889.35169forward
CNT30364958Lolium perenneSorghum bicolor43.241.7887.37483forward
CNT30595697Lolium perenneOryza meridionalis8.7720.7688.7898forward
CNT30323306Lolium perenneAsparagus officinalis7.1620.158580forward
CNT30575127Lolium perenneOryza barthii35.631.8787.69398forward
CNT30583774Lolium perenneEchinochloa crusgalli43.2928.3585.95484forward

Expression of CNT30139418

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MSQPRTCCCTRRHPCGPPWARRRCTPLPRATWPWRRGWGQIGSTRRGWA*

>peptide 2 (59 aa)
TKLTDAKSKDFSKKLPFDVQLFRHKHEMRWSTTTQHRDDEMTANAMTDAHNTRDGHRPN*

>peptide 3 (85 aa)
MKPKCPSLELVAVPEDTLAVLRGLDVDALLCLAPRGLGDGGGVKLVVLAEDGLDRLGGLHGVVVRHGGEEVMRTSHALTMSSGTA*

Sequence

>CNT30139418
ACAAAACTCACTGACGCCAAGTCTAAAGATTTCTCAAAAAAGTTGCCGTTTGATGTTCAGTTATTCCGCCATAAACACGAGATGAGATGGTCTACAACAA
CACAACACAGGGACGATGAGATGACAGCCAATGCAATGACAGACGCACACAACACAAGGGACGGTCACCGGCCAAACTAAACCGGCGACTACAAGGCAGA
GAAAGTAAAGACGACGGAACTGACGACCAAAGCCACGGACACGCTACTCCTTTGCACCTGCTGCAACTCTTCTAGCATTGGCACGGTGATGATAGTCTTC
CTCCTTGCGCCCAGATGCTCTCTTCTATCTAATAAAGACTAACCAACCATACGTAGGTAGAACTTGTTGGTGTAGGATCTCTTCCAGAGTTCTTCCTCAC
ATTCCAGCAGCAGGGTTCATGAAACCCAAATGTCCCAGCCTAGAACTTGTTGCTGTACCAGAAGACACCCTTGCGGTCCTCCGTGGGCTCGACGTAGATG
CACTCCTTTGCCTCGCGCCACGTGGCCTTGGCGACGGGGGTGGGGTCAAATTGGTAGTACTCGCCGAGGATGGGCTTGATCGCCTTGGTGGCCTCCATGG
CGTGGTAGTGCGGCATGGTGGAGAAGAGGTGATGAGGACCAGCCACGCGTTGACGATGAGCAGCGGCACCGCGTAGACGCGCACCACCCACCAGAACCCG
AACGCCGACGCGAGCTTGAAGAGGCCGAACGAGGTGGCCAGCACGCCGACGTCCGAGATGAAGATCTGGACGCGCTCACGGTCGTTGTAGATGGGGCCGT
AGGGGTCGAAGTGGCACGCGAAGCGCGGGTATGGGCGGCCCGAGGCGTTCGTCGCCAGGTACAGCGGCCACCCAAGGGTGAGCTGCACCACGATGTGCAC
CAGGCGGCCGGCTGGGTTGTTGTAGATGTAGGGGGTGTACCACGCGAGCGCATCCTTCTTCTTGGGGACGAACACCTCGTCGCGCTCCATGGAACCGGTG
TTGGAGTGGTGGCGACGGTGGCTGTACTTCCAGGAGAAGTAGGGGACGAGCAGCCACGAGTGGAGCACCAGGCCCACGATGTCATCGAGCAGCGAGTAGT
CGGAGAAGGCGTGATGGC