Detailed information on CNT30137565


BLAST search results

BLAST vs Swiss-Prot:
sp|Q39255|SKP1A_ARATH, E-value = 2e-35

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671810Lolium perenneSetaria viridis6.638.4693.6895forward
CNT30535942Lolium perenneEucalyptus grandis10.3531.9783.89149forward
CNT30516841Lolium perenneJuglans regia11.5320.4983.73166forward
CNT30666847Lolium perenneTriticum dicoccoides4.6526.9110067forward
CNT3059890Lolium perenneArabidopsis lyrata10.5621.1483.55152forward
CNT30259882Lolium perenneBrassica rapa8.6832.7287.2125forward
CNT30592895Lolium perenneEragrostis curvula15.944.1290.83229forward

Expression of CNT30137565

Peptides detected in this lncRNA

>peptide 1 (42 aa)
TFQRPCWYDHICSPQCENSGSLLPYAICCSCMSTSKINCYAS*

>peptide 2 (45 aa)
PLSSVLAGMITFAPLNARTLAVSFPMPFVAPACQQVKSTVMPPRF*

>peptide 3 (29 aa)
MIAQLFYSGSSAPKWNNYENSTALLSSLH*

>peptide 4 (37 aa)
MRSKRVAWSTLTNSASQFLRSSAGAGGAAAEELVIIFL

>peptide 5 (32 aa)
MLKVLRISSGVLPLIMSATVWQVRSSRPLMLR*

Sequence

>CNT30137565
CCACTTTCCAGCGTCCTTGCTGGTATGATCACATTTGCTCCCCTCAATGCGAGAACTCTGGCAGTCTCCTTCCCTATGCCATTTGTTGCTCCTGCATGTC
AACAAGTAAAATCAACTGTTATGCCTCCTAGGTTCTGAACAGATTATACTACAGGTTGGCTTGTGAACCATGATAGCTCAATTATTTTATTCAGGAAGCT
CTGCTCCAAAATGGAACAATTATGAAAACAGTACTGCTTTGCTCAGTTCATTGCATTAATAGAACCTGCTACTACATCCTCTTGGAAGATTGAACAATAC
AGTATGACATAGAAATATCTTATTGCAGTAATGGAACCTAGACTTGATACAGGTTTACGGTAAAACAACAAAATAGTAGTAATAATGCATCTTCTTAGAA
GATTGAACAATAGTATTACAGTACATATTTCTTCTAATCTGCCAATGTAAAACTTTATTTTAGCTAGCAAAAGATCCACTTGATTGGGTTCACAAGTTAT
GACCGCTGACTAATGATAGATAGTTTTCGTTCCAGACATAACCAACCACTGAAGTAAAATGTTCAGAAACCAGGGTTTGCGGTAAAACAACAAAATAGTA
CTACTATTATTACATCTTCTTACAGATTGAACAATAGTGTTGTTACAGTACAGATTTCTTGTAATCTGCCAAAGCAAAATATCCACTTGACAATACCAAT
TTTGTTCACAAATTATGACCACTGATCAATGATAGATAGTTTTGTTCCAGACATGACCAACCACTGAAGATAGATGTTGACAAACTGGACCTAGACTTGA
TGCTTGTTTACGGTAAAACAACAAATAAATACTACAGTACTACTATTACATCTTGTTATAAGATTGAACAATAGTACTATTACAGTACATGTTTCTTGGA
ATCTGATAAATAAAATTTTATACTTACCAAGCAAAAGCTCCACTTGATTCAGTTCACAAGTTATGACCGCTGATCAATGATAGATAGTTTTCATTCCAGA
CATAACCAACCACTGAAGATAGATAGATAGATGTTCATAAACCGGACCTCGACTCAAAGATAATTATTACATAAAAGGTAGTAGCAGCGTCGGAAATAGC
GAGTTTCAGGATCCATCATCAACGCGGCCGCGGCAGGGTAGTGTGGCTCTACTCGAAAGCCCACTGGTTCTCCCTGCGGATCTCCTCCTCCTCCTCGGCG
GTGAAGTCGTTCTTGATGTTGAAGGTCTTGCGGATCTCCTCGGGGGTCTTGCCCTTGATCATGTCGGCGACGGTCTGGCAGGTGAGGTCGAGCAGGCCCT
TGATGTTGAGGTAGTTGGCGGCGAGGATGAGGTCGAAGAGGGTGGCCTGGTCGACCTTGACGAACTCGGCGTCCCAGTTCTTGAGGTCCTCGGCGGGCGC
GGGCGGGGCGGCGGCGGAGGAGCTGGTGATCATCTTCTTG