Detailed information on CNT3013737


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671649Zea maysSetaria viridis51.0770.2184.03238forward
CNT30520631Zea maysSetaria italica29.619.6493.48138forward
CNT30179479Zea maysSecale cereale23.3915.7593.58109forward
CNT30288841Zea maysTriticum aestivum23.3920.0492.66109forward
CNT30387274Zea maysTriticum turgidum23.3924.3392.66109forward
CNT30244332Zea maysAvena sativa22.5312.9289.52105forward
CNT30659169Zea maysTriticum dicoccoides23.3914.0192.66109forward
CNT30454075Zea maysSaccharum spontaneum58.1529.6888.93271forward
CNT30133575Zea maysLolium perenne23.8217.4589.19111forward
CNT30680618Zea maysTriticum urartu23.3911.3491.74109forward
CNT30338965Zea maysEragrostis tef21.2431.5393.9499forward
CNT30581058Zea maysEchinochloa crusgalli23.1811.0797.22108forward
CNT30556732Zea maysPanicum hallii24.2514.4996.46113forward
CNT30551395Zea maysOryza brachyantha23.3912.5991.74109forward

Expression of CNT3013737

Peptides detected in this lncRNA

>peptide 1 (84 aa)
MAGLRGPSERVEDGSVERVDVFATFFGAGFALPPNPNPNRATMRPFCGAGSARRVPRNVLAAAATDEAMAAPPRTLLGVLRLVCG

>peptide 2 (67 aa)
MVVWSGSMSSPPSSEQASPCRPTRTRTGPRCARSVAPGPPGGCPGMCSPRRPPMKPWLLLHVLSLVC*

>peptide 3 (55 aa)
VGSYITNHQVPAVALLINEISINKGSILSSSLSHSSQNETTHDGLIHPQAHRDRS*

Sequence

>CNT3013737
GGTTGGATCATATATTACAAACCACCAAGTCCCAGCGGTAGCTCTCCTAATTAACGAGATCTCCATTAACAAAGGATCGATCTTGTCATCCTCTCTCTCC
CACTCATCACAAAACGAGACCACGCACGACGGGTTGATCCATCCCCAGGCTCATAGAGATCGTAGTTAATTAATCCAAGAACACGTTCCGGTCGATGGAC
GGGGCGGAGCAATGGCGGGCTTAAGAGGACCCTCCGAACGTGTCGAAGATGGTAGTGTGGAGCGGGTCGATGTCTTCGCCACCTTCTTCGGAGCAGGCTT
CGCCTTGCCGCCCAACCCGAACCCGAACCGGGCCACGATGCGCCCGTTCTGTGGCGCCGGGTCCGCCAGGCGGGTGCCCAGGAATGTGCTCGCCGCGGCG
GCCACCGATGAAGCCATGGCTGCTCCTCCACGTACTCTCCTTGGTGTGCTGAGGTTGGTGTGTGGC