Detailed information on CNT30137220


BLAST search results

BLAST vs Swiss-Prot:
sp|P50156|TIP11_ORYSJ, E-value = 4e-44

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678075Lolium perenneSetaria viridis18.2652.2487.31268forward
CNT30522256Lolium perenneSetaria italica8.6527.1488.98127forward
CNT30592382Lolium perenneMusa acuminata19.8949.0886.64292forward
CNT30247019Lolium perenneAvena sativa22.4826.8590.61330forward
CNT30662885Lolium perenneTriticum dicoccoides9.661.8494.33141forward
CNT30331222Lolium perenneDioscorea rotundata12.1922.883.24179forward
CNT30575580Lolium perenneOryza barthii8.0435.2288.98118forward

Expression of CNT30137220

Peptides detected in this lncRNA

>peptide 1 (60 aa)
MLPPRKAPKVTAGFTCPPEMLAPTDTATNRAKACAMAAAISPIGASVPPLSLAAHAQIQD*

>peptide 2 (55 aa)
MSVEMNSASAALRAPVSYTSWWLPTAILLTGIFSQLASSHTPAEAARGRRLAGAER

>peptide 3 (61 aa)
MISMPHGVMPRSGKDMILHVISRANKSSAPIILHLKGRMTPPLSDFLKQNFSRLLVKCFFF*

>peptide 4 (44 aa)
MTISSTSASQQDTPERAKKPVGSPPVAKRRRKQAAVEPRSWAIQ*

>peptide 5 (48 aa)
MHSFYISKLIDDMGSRYHISTVYSSRHHRLTDRLIEMIQSKLTRRSRN*

Sequence

>CNT30137220
CTTGAGACTTGGAACTGAACTGAACTTGAAAATACACCGGGCGAATGCACAGTTTTTACATAAGCAAATTGATTGATGACATGGGTTCCAGATACCATAT
ATCCACGGTTTACAGCTCAAGGCACCACAGACTCACTGACCGACTGATCGAAATGATTCAAAGCAAATTAACGAGGCGATCGAGGAACTAAAAGGAACGA
TTCATGCATGCGATGGAAGCGGTAGGTCGATCTTCACACGACGAACGGAAGGAAGGGAGCCACGGACCAAGCTGGTTGGCTTAGTAGTCGGTGGTGGGGA
GCTGCTCGTGGCTGCGGTTGATGAAGAGGAGCTCGTAGACGACGCCGGCGAGGCCGAAGGTCATGACGATCTCCAGCACCAGCGCCTCCCAGCAGGACAC
GCCGGAGAGGGCGAAGAAGCCGGTGGGGAGCCCGCCGGTGGCGAAGCGGAGGAGGAAGCAGGCGGCGGTGGAGCCGAGAAGCTGGGCGATCCAGTAGAGC
AGGCCGCGGAAGAGGGTGATGTTGCCGCCCAGGAAGGCGCCGAAGGTCACGGCCGGGTTCACGTGCCCGCCCGAGATGTTGGCGCCCACGGACACCGCCA
CGAACAGGGCGAAGGCGTGCGCGATGGCCGCCGCGATCAGCCCGATCGGGGCGTCCGTGCCGCCGCTCAGCTTGGCTGCACACGCACAAATCCAAGACTA
GTCAGATACTGGATCAGTGAAGCAAGTGCTTGATTCCTTAAAAGTTTCCCCATTTATCTCTACCGTTTGGAGAAGCTAGCTGGGTTGTTAATTCAGCTGC
TGCAAGTGTGTCATTTTTTGCTACTTGTGGACACTAGAGAGCACATGGCATGTGTGTGTGTGTGTGTCAGAGTGACTGGATCTGAAGTTCTGAACAGAAG
CTGCTGACTGATGATTTCCATGCCTCATGGAGTCATGCCTAGGAGTGGGAAAGATATGATTCTCCACGTAATCTCAAGGGCAAACAAGTCATCTGCACCA
ATCATTCTCCACCTAAAAGGCCGTATGACACCACCACTTTCTGACTTTCTGAAACAAAACTTCTCTAGGCTTCTAGTAAAGTGTTTCTTCTTTTAAGCGT
GATGGAAAGGGATTTTGTCTCCAAATGCAAGTGGCGGTTTTTTTCCTTTTCTTTGTGGTGAGCGTGCGTACTACGATATATGCAGATTCATGAACTTGCT
CCTAATCTAATCTAATCCATGACATGGTGTACGCGAGGCTGGGAAACTAATTGACGACTCACCGAAGGCGACGCCGGAGCCCTGGCCGGCGAAGACGAAG
ATGAGCGTGGAGATGAACTCCGCGAGCGCCGCCTTGAGGGCGCCGGTCTCGTACACCTCATGGTGGCTCCCCACGGCGATCCTGCTGACCGGCATTTTCT
CTCAGCTGGCTAGCTCTCACACACCTGCAGAAGCAGCTAGAGGAAGAAGATTGGCCGGAGCTGAGAGA