Detailed information on CNT30137065


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9XF89|CB5_ARATH, E-value = 3e-31

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697405Lolium perenneOryza sativa35.0135.2492.5160forward
CNT30677012Lolium perenneSetaria viridis45.0829.2290.29206forward
CNT30524410Lolium perenneSetaria italica45.0826.3490.29206forward
CNT30295213Lolium perenneTriticum aestivum70.0257.9790.31320forward
CNT30223445Lolium perenneHordeum vulgare55.860.1488.63255forward
CNT30390938Lolium perenneTriticum turgidum49.0242.6787.5224forward
CNT30555388Lolium perenneOryza glaberrima33.0429.9692.72151forward
CNT30439442Lolium perenneAegilops tauschii33.4851.3496.08153forward
CNT30256287Lolium perenneAvena sativa41.1443.4292.55188forward
CNT30662940Lolium perenneTriticum dicoccoides59.9670.0889.42274forward
CNT30465769Lolium perenneSaccharum spontaneum45.0835.8389.81206forward
CNT30721254Lolium perenneTriticum spelta54.744.8888.8250forward
CNT30353507Lolium perenneEragrostis tef45.7316.3592.82209forward
CNT30365046Lolium perenneSorghum bicolor44.8621.2990.73205forward
CNT30597113Lolium perenneOryza meridionalis62.363882.11285forward
CNT30150882Lolium perenneBrachypodium distachyon48.1466.8783.18220forward
CNT30103835Lolium perenneOryza rufipogon44.4242.3885.71203forward
CNT30578126Lolium perenneOryza barthii44.4224.1194.09203forward
CNT30498372Lolium perenneDigitaria exilis44.4242.7490.15203forward
CNT30117889Lolium perenneOryza nivara42.8934.6994.39196forward

Expression of CNT30137065

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MQLIIDKATAADELAINGELTGWASSRRRRR*

>peptide 2 (48 aa)
MKKPSMENMARRPFLISFTLSSAAWSGSVDGNAAAEVVEGVSVKEKGAG

>peptide 3 (36 aa)
MFLLALIIYTHGHIRTLDTFPGKINTAHHAALHACS*

Sequence

>CNT30137065
TGGAGAGGTATAAGAAATCAGAAAGATCATGTTTCTTCTGGCCTTGATAATTTACACGCACGGGCACATCCGTACTCTTGATACTTTTCCCGGTAAAATT
AACACAGCGCATCATGCTGCATTGCACGCATGCAGCTGATCATCGACAAAGCGACGGCGGCGGACGAACTGGCAATTAACGGCGAGCTCACAGGCTGGGC
GTCCTCTCGGCGGCGCCGGAGATGACGGTGAGCAGGTTGTTGCCGAAGGGGTCGCTGAGGTGCGCGCACAGGTTCTCGTAGGGGCCCTGGCCGGTGACGT
AGGCCTGGATGAAGAAACCCAGCATGGAGAACATGGCCAGGCGTCCGTTCTTGATCTCCTTCACCTTGAGCAGCGCCGCCTGGTCGGGGTCGGTTGATGG
GAATGCTGCTGCCGAAGTAGTTGAGGGTGTTTCCGTCAAGGAGAAGGGCGCCGGTCT