CANTATAdb - search

Detailed information on CNT30137004

BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)

Target	Query species	Target species	Query coverage (%)	Target coverage (%)	Identity	Alignment length (nt)	Orientation
CNT30678059	Lolium perenne	Setaria viridis	36.32	15.71	95.29	85	forward
CNT30500546	Lolium perenne	Coffea canephora	33.76	17.06	92.41	79	forward
CNT30503465	Lolium perenne	Nicotiana attenuata	33.33	15.03	92.31	78	forward
CNT30307634	Lolium perenne	Triticum aestivum	34.19	12.52	93.75	80	forward
CNT30223926	Lolium perenne	Hordeum vulgare	37.18	14.12	96.55	87	forward
CNT30235682	Lolium perenne	Brassica oleracea	33.33	15.29	91.03	78	forward
CNT30442977	Lolium perenne	Aegilops tauschii	29.91	14.93	92.86	70	forward
CNT3060687	Lolium perenne	Arabidopsis lyrata	33.33	20	89.74	78	forward
CNT3081183	Lolium perenne	Brassica juncea	36.32	16.16	90.59	85	forward
CNT30446643	Lolium perenne	Saccharum spontaneum	37.18	17.98	96.55	87	forward
CNT309411	Lolium perenne	Zea mays	37.18	14.5	90.8	87	forward
CNT30207458	Lolium perenne	Helianthus annuus	32.91	13.85	93.51	77	forward
CNT30626608	Lolium perenne	Daucus carota	33.33	9.18	93.59	78	forward
CNT30348900	Lolium perenne	Eragrostis tef	37.18	18.75	96.55	87	forward
CNT30363122	Lolium perenne	Sorghum bicolor	29.91	17.9	91.43	70	reverse complement
CNT30596688	Lolium perenne	Oryza meridionalis	34.62	15.03	92.59	81	forward
CNT30359324	Lolium perenne	Lactuca sativa	30.77	12.08	93.06	72	forward
CNT3057178	Lolium perenne	Amborella trichopoda	33.33	13.52	92.31	78	reverse complement
CNT30326905	Lolium perenne	Asparagus officinalis	33.33	17.77	94.87	78	forward
CNT3038456	Lolium perenne	Cucumis melo	33.33	15.6	91.03	78	forward
CNT30579574	Lolium perenne	Echinochloa crusgalli	36.75	17.37	96.51	86	forward
CNT30593864	Lolium perenne	Eragrostis curvula	37.18	15.59	96.55	87	forward
CNT30604511	Lolium perenne	Oryza punctata	33.76	15.16	92.41	79	forward
CNT30556718	Lolium perenne	Panicum hallii	35.47	18.53	92.77	83	forward
CNT30551345	Lolium perenne	Oryza brachyantha	35.47	14.82	91.57	83	forward
CNT30115058	Lolium perenne	Eutrema salsugineum	36.32	19.19	90.59	85	forward

Expression of CNT30137004

Peptides detected in this lncRNA

>peptide 1 (56 aa)
LRHHLRDEGQVEEEENEEAQEEATKDEAAIEVGAQQGRLPLSIGIFSFMMCFVGDF*

>peptide 2 (32 aa)
CCATTSAMRAKWKKKRMRRLKRKRRKMRQRSK*

Sequence

>CNT30137004
TGTTGCGCCACCACCTCCGCGATGAGGGCCAAGTGGAAGAAGAAGAGAATGAGGAGGCTCAAGAGGAAGCGACGAAAGATGAGGCAGCGATCGAAGTAGG
CGCACAACAAGGGAGATTGCCTCTTTCTATTGGGATCTTCTCATTCATGATGTGCTTTGTTGGTGACTTTTGATTCCTGATATGTAGGTTATGAATGTAG
GAGATCTGAACCCTTGTTATATGAGGATGATCAT