Detailed information on CNT30136604


BLAST search results

BLAST vs Swiss-Prot:
sp|Q94AK6|SAG20_ARATH, E-value = 7e-20

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30100797Lolium perenneOryza rufipogon39.1733.7189.36329forward
CNT30575483Lolium perenneOryza barthii39.1733.6189.36329forward

Expression of CNT30136604

Peptides detected in this lncRNA

>peptide 1 (87 aa)
MARTRPGSDLRARSARRLCHRHLGHLGVGAGEEGAEEEAWLGETIVLGFLLAAAAAAERRVTVRSVLKYSLSCVITPSGPTVQACTQ*

>peptide 2 (30 aa)
MEPPLEVRGEQLLRPARVAGVERLVQAQHQE

>peptide 3 (66 aa)
MTVEPKASTERGAKVNWALVSAPVRRRIMCWCAGGPWNHHSRSGASSSCARRASRALSASYRRSTRN

Sequence

>CNT30136604
ACCATGTGAGAGTAAGCAAATGAGAAAGGGAGAAAAGAAATGAAGGCAAATAACTATCCGAATACATTGCATAAGACTCAAATACTCTCTGCTAGTACTT
TTATTCAGCCGCAATAGCGAGCCATTGCTGCAGCTGCAGTACACACCATAAGGTCCACAACCCATAACTTAGACCGAGCAAATCACACTTTCTAATTCAA
ACACGTAAAGCAATACTATTGGTAGAGGAAATGTGGGATCCCTGAATTCTAGCACGCACTTCAGTTCAGTTCAGTTCGCCCATACGCCAGCTCCTTGACT
TCTTGAGTTCTTGCAGATAAGTAGTCCCTGAATTCTTGTTAGATGGCGAGGACGAGGCCCGGCAGCGACTTGCGCGCGCGGTCAGCGCGGCGGCTCTGCC
ACAGGCACTTGGGCCACTTGGGCGTGGGCGCCGGCGAGGAGGGCGCTGAAGAGGAGGCGTGGCTAGGAGAGACGATTGTGCTGGGGTTCTTGCTGGCGGC
GGCGGCGGCGGCGGAGAGGCGGGTGACGGTGAGGTCGGTGTTGAAGTACTCCCTGAGCTGCGTGATCACCCCATCGGGTCCGACGGTCCAGGCGTGCACC
CAGTAGAGCTGTCCGCCAGCGTCGGCGCCTCCCTCGGCGATGACGGTGGAGCCGAAGGCGTCGACGGAGCGCGGGGCGAAGGTGAACTGGGCGTTGGTGT
CGGCGCCGGTGAGGAGGCGCATCATGTGCTGGTGCGCGGGCGGGCCATGGAACCACCACTCGAGGTCCGGGGCGAGCAGCTCCTGCGCCCGGCGCGCGTC
GCGGGCGTTGAGCGCCTCGTACAGGCGCAGCACCAGGAAC