Detailed information on CNT30136463


BLAST search results

BLAST vs Swiss-Prot:
sp|O64964|TIP11_MAIZE, E-value = 3e-75

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677458Lolium perenneSetaria viridis24.1541.2692.09177forward
CNT30618329Lolium perenneSesamum indicum21.6912.985.53159forward
CNT30628532Lolium perenneVigna unguiculata18.2833.0983.58134forward
CNT30296934Lolium perenneTriticum aestivum24.1532.994.35177forward
CNT30392788Lolium perenneTriticum turgidum33.5618.8993.09246forward
CNT30586176Lolium perenneMusa acuminata33.0239.6787.6242forward
CNT3084543Lolium perenneVigna radiata13.6426.3988100forward
CNT30553179Lolium perenneOryza glaberrima20.0521.2490.48147forward
CNT30146855Lolium perenneMedicago truncatula15.2837.4681.25112forward
CNT30242094Lolium perenneAvena sativa27.4254.6295.02201forward
CNT301194Lolium perenneZea mays36.0252.9189.77264forward
CNT30229576Lolium perenneAnanas comosus23.8724.5887.43175forward
CNT3066802Lolium perenneLeersia perrieri18.9658.6593.53139forward
CNT30623609Lolium perenneDaucus carota22.7829.7282.63167forward
CNT30361046Lolium perenneSorghum bicolor18.9622.3192.81139forward
CNT30619906Lolium perenneCajanus cajan15.5551.8292.11114forward
CNT30596416Lolium perenneOryza meridionalis13.9222.4791.18102forward
CNT30369235Lolium perenneOryza glumipatula23.1915.0790170forward
CNT3057351Lolium perenneAmborella trichopoda31.5127.1482.25231forward
CNT30579791Lolium perenneEchinochloa crusgalli36.9721.5190.41271forward
CNT30176366Lolium perenneVigna angularis15.4223.5984.07113forward

Expression of CNT30136463

Peptides detected in this lncRNA

>peptide 1 (65 aa)
MSGPTQYTHWYPHSQLTRAGPKDTAGFMEAPLKAPPTRILAPTMKPMAMGAMVPSSPFLGSTAVA*

>peptide 2 (45 aa)
MLPPRKAPKVTAGFTCPPEMLAPTDTATNRAKACAMAAAISPIGAS

>peptide 3 (48 aa)
MHSFYISKLIDDMGSRYHISTVYSSRHHRLTDRLIEMIQSKLTRRSRN*

Sequence

>CNT30136463
GTAACTTGAGACTTGGAACTGAACTGAACTTGAAAATACACCGGGCGAATGCACAGTTTTTACATAAGCAAATTGATTGATGACATGGGTTCCAGATACC
ATATATCCACGGTTTACAGCTCAAGGCACCACAGACTCACTGACCGACTGATCGAAATGATTCAAAGCAAATTAACGAGGCGATCGAGGAACTAAAAGGA
ACGATTCATGCATGCGATGGAAGCGGTAGGTCGATCTTCACACGACGAACGGAAGGAAGGGAGCCACGGACCAAGCTGGTTGGCTTAGTAGTCGGTGGTG
GGGAGCTGCTCGTGGCTGCGGTTGATGAAGAGGAGCTCGTAGACGACGCCGGCGAGGCCACCGCCGATGAGTGGGCCGACCCAGTACACCCACTGGTATC
CCCACTCCCAGCTGACGAGGGCGGGGCCGAAGGACACGGCGGGGTTCATGGAGGCGCCGCTAAAGGCGCCGCCGACGAGGATATTGGCGCCGACGATGAA
ACCGATGGCGATGGGCGCGATGGTGCCGAGCTCGCCCTTCTTGGGGTCGACGGCGGTGGCGTAGACGGTGTAGACGAGGCCGCGGAAGAGGGTGATGTTG
CCGCCCAGGAAGGCGCCGAAGGTCACGGCCGGGTTCACGTGCCCGCCCGAGATGTTGGCGCCCACGGACACCGCCACGAACAGGGCGAAGGCGTGCGCGA
TGGCCGCCGCGATCAGCCCGATCGGGGCGTCCG