Detailed information on CNT30136430


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 7e-101

BLAST vs NONCODE:
NONMEST001181, E-value = 7e-68

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30136430

Peptides detected in this lncRNA

>peptide 1 (59 aa)
QIDFTGHSKEPVNQNSNKSSTGWIKFKLFHNWNCCTSNCLHETNTHIGYSMVHYTDTVN*

>peptide 2 (44 aa)
MPSLSWILALTLSMVSEDSTSRVMVLPVRVLTKICMPPRRRRTR*

>peptide 3 (43 aa)
MRRCWSGGMPSLSWILALTLPMVSEDSTSRVMVLPVRVFTKICI

Sequence

>CNT30136430
TCCAAATCGATTTCACAGGGCATTCAAAAGAACCAGTAAACCAAAACAGCAATAAATCGAGCACAGGCTGGATTAAGTTCAAACTTTTTCATAATTGGAA
CTGCTGCACCAGCAACTGTTTGCACGAAACCAACACACATATAGGGTACTCAATGGTCCATTATACAGACACGGTAAACTAGATACGAAGACAGACTCTT
CACAACAGGGGCAGCCCACTGGACAACCAAGGGATACAGCAGCAGCTCCAACCACTAAGACACTTACTGACCGCCACGGAGGCGGAGCACCAGGTGGAGG
GTGGACTCCTTCTGGATGTTGTAGTCGGCGAGGGTGCGGCCATCCTCCAATTGCTTGCCTGCAAAGATCAGGCGCTGCTGGTCAGGGGGGATGCCCTCCT
TGTCCTGGATCTTGGCCTTGACATTGTCAATGGTGTCTGAAGACTCCACCTCAAGGGTGATGGTCTTGCCAGTGAGGGTCTTGACGAAGATCTGCATGCC
ACCCCGAAGACGGAGGACAAGGTGAAGGGTGGACTCCTTTTGGATGTTGTAATCAGCGAGGGTCCTGCCGTCCTCCAGCTGCTTGCCAGCAAAGATGAGG
CGCTGCTGGTCCGGAGGGATGCCCTCCTTATCCTGGATCTTGGCCTTGACATTGCCGATGGTGTCAGAGGACTCCACCTCAAGGGTGATGGTCTTGCCCG
TGAGGGTCTTCACAAAGATCTGCATCT