Detailed information on CNT30136319


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006943, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675397Lolium perenneSetaria viridis47.2885.1396.65269forward
CNT30378667Lolium perenneArabidopsis thaliana33.2216.8996.83189reverse complement
CNT30503431Lolium perenneNicotiana attenuata60.4624.9196.51344forward
CNT30708588Lolium perenneGlycine max28.1271.1195160forward
CNT30193689Lolium perenneSecale cereale81.3737.4699.57463reverse complement
CNT3088853Lolium perenneVigna radiata46.9265.9395.88267forward
CNT30511396Lolium perenneSolanum lycopersicum54.4833.8894.84310reverse complement
CNT30554621Lolium perenneOryza glaberrima36.5696.7499.52208reverse complement
CNT30664460Lolium perenneTriticum dicoccoides63.4499.7299.45361reverse complement
CNT3062651Lolium perenneArabidopsis lyrata80.8455.2996.3460forward
CNT3068134Lolium perenneLeersia perrieri59.9394.294.13341forward
CNT30126841Lolium perenneCorymbia citriodora60.6392.7493.04345reverse complement
CNT30370808Lolium perenneOryza glumipatula36.5695.85100208reverse complement
CNT30646295Lolium perenneCannabis sativa74.5249.3693.16424reverse complement

Expression of CNT30136319

Peptides detected in this lncRNA

>peptide 1 (61 aa)
LALTAPYRDHRIDSNKPCLKRFIYGTPGNYTWSRTFSLPLRRPPLSRLLPSKAERSPTDAF*

Sequence

>CNT30136319
ACTCGCGCTGACCGCGCCCTATAGGGATCATCGAATCGATAGCAATAAGCCCTGTTTGAAGAGGTTCATATACGGAACGCCTGGAAATTATACTTGGAGC
AGGACATTCTCGCTTCCGCTTCGTCGACCCCCGCTTTCGCGGTTGCTTCCCTCTAAGGCGGAACGCTCCCCTACCGATGCATTTTGACATCCCACAGCTT
CGGCAGATCGCTTAGCCCCGTTCATCTTCAGCGCAAGGGCGCTCGATCAGTGAGCTATTACGCACTCTTTAAAGGGTGGCTGCTTCTAGGCAAACCTCCT
GGCTGTCTTTGCACCCCCACCTCCTTTATCACTGAGCGGTCATTTAGGGGCCTTAGCTGGTGATCCGGGCTGTTTCCCTCTCGACGATGAAGCTTATCCC
CCATCGTCTCACTGGCCGACCTTGATCCCTGTTATTTTTGGGTCATATCTAGTATTCAGAGTTTGCCTCGATTTGGTACCGCTCGCGCAGCCCGCACCGA
AACAGTGCTTTACCCCTAGATGTCCAGTCAACTGCTGCGCCTCAACGCATTTCGGGGAGAACCAGGCCG