Detailed information on CNT30136219


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QYL2|NLT2B_ORYSJ, E-value = 3e-25

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676294Lolium perenneSetaria viridis11.7927.6392.9671forward
CNT30523932Lolium perenneSetaria italica11.7920.2992.9671forward
CNT30371496Lolium perenneOryza glumipatula20.4341.2888.62123forward
CNT30104730Lolium perenneOryza rufipogon20.4335.8688.62123forward
CNT30578036Lolium perenneOryza barthii19.138.5987.83115forward
CNT30117882Lolium perenneOryza nivara20.4328.2888.62123forward

Expression of CNT30136219

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MAALAAKGAERSIAATMATTTIWAAAERAISYLELVVSWVWLEMR*

>peptide 2 (69 aa)
PLCLEVSNKHNRIYREMQLTQTSIHYTGTLAVHKHGVQSKLSMVSPQMERREQLNTDTMPAGHGELVRV*

>peptide 3 (40 aa)
MLTPHLEGMLAALPALIPLMLPTNFLRQLQAMQGLKAELT*

Sequence

>CNT30136219
CCCCTTTGTGTTTAGAAGTTTCAAACAAGCATAATAGAATATACAGAGAGATGCAATTGACACAAACAAGCATACACTACACTGGCACTCTGGCAGTGCA
TAAACATGGTGTACAAAGCAAACTCTCGATGGTTTCTCCTCAAATGGAGAGAAGGGAACAACTAAACACCGATACAATGCCGGCCGGCCACGGAGAGCTG
GTTCGAGTGTAAACGTGTGTGACGCCGGTTCGGAGTAGTGGATGGATCAGTTGATGCTGTTGCAGTTGACGGAGGTGCTGATGGCGTAGGGGATGCTGAC
GCCACACTTGGAGGGGATGCTGGCGGCGTTACCGGCCTTGATCCCGCTAATGCTGCCGACCAATTTCTTGAGGCAGTTGCAGGCCATGCAGGGGCTCAAG
GCAGAGCTCACCTGACCACAGGAGATGGCGGCGTTGGCGGCGAAAGGCGCCGAGAGGAGCATCGCCGCCACAATGGCGACCACCACGATCTGGGCTGCTG
CAGAGCGGGCCATCTCTTACCTTGAGCTAGTGGTGAGCTGGGTGTGGCTGGAGATGAGGTAGCTAGATTTGCTAGATGGAGCAAGTGATGGTGGGTGAGG
AG