Detailed information on CNT3013606


BLAST search results

BLAST vs Swiss-Prot:
sp|P12329|CB21_MAIZE, E-value = 1e-140

BLAST vs NONCODE:
NONSTUT001352, E-value = 1e-14

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30641254Zea maysNymphaea colorata48.249.1686.29496forward
CNT30534267Zea maysEucalyptus grandis45.2946.2386.7466forward
CNT30251114Zea maysAvena sativa59.3858.4790.51611forward
CNT30664832Zea maysTriticum dicoccoides52.7759.6793.19543forward
CNT30363113Zea maysSorghum bicolor58.661.2294.03603forward
CNT30581184Zea maysEchinochloa crusgalli58.026793.47597forward
CNT30556492Zea maysPanicum hallii59.2866.5295.41610forward

Expression of CNT3013606

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MAQREWITSSSRFLANVSGSADSPAVSQP*

>peptide 2 (33 aa)
MQCNVKQKTHMHLAASINPRTYTLSDPKDNEVA*

>peptide 3 (46 aa)
MVMRPSPKEPTLMGVPAIAVEEIAMVEAAIAEAERESVGPVAIDAAG

>peptide 4 (49 aa)
MAWTKKPNMENMARRPFLSSFTLSSAKASGSSAQMARMLCAWIRLGLPR*

Sequence

>CNT3013606
TACTTTCATTTTCATTGATATCTGCTGTTTATCCAAGCACATTTATGCTTGCCTTCTTAAGATAAAGAGCTAGAGAGAAAAAGGAGTATAGAAGAAAAAC
AAATTAATGGATATCAACAATTAACCAGCAGGAAACAAAAACCACCACTATTGCACAAACATGGTTCATCTTAGTGTACAACGCCAACTCATCATCTCGA
CTTGCCTATGCAATGCAACGTGAAACAAAAGACACACATGCATCTCGCAGCATCAATCAATCCACGTACGTACACCCTCTCCGATCCGAAAGACAATGAA
GTTGCATAGCATAGCCGTTGAGCTTAGTTGCCGGGGACGAAGTTGGTGGCGTAGGCCCATGCGTTGTTGTTGACTGGGTTCTCGAGCGGGCCCTTGCCGG
TGACGATGGCCTGGACGAAGAAGCCGAACATGGAAAACATGGCGAGGCGGCCGTTCTTGAGCTCCTTCACCTTGAGCTCGGCGAAGGCCTCGGGGTCGTC
GGCCCAGATGGCGAGGATGCTCTGCGCGTGGATCAGGCTGGGGTTGCCGAGGTAGTCCAGCCCGCCCTCGCTGAAGATCTGGGAGCCGGCCTTGAACCAG
ACGGCCTCGCCGAACTTGACGCCGTTGCGGGAGAGCAGCTCGGGGAAGACGCAGCCGAGCGCGCCGAGCATGGCCCAGCGGGAGTGGATCACCTCCAGCT
CGCGGTTCTTGGCGAATGTCTCGGGGTCGGCGGACAGCCCGGCGGTGTCCCAGCCGTAGTCGCCGGGGAACTCGCCGGTGAGGTAGCTCGGGGGCTCGCC
GGAGAAGGGGCCGAGGTACTTGACGCGGTCGGGGCCGTACCAGGGGCTGCCGGACGCCGCCACCTTGGGCTTGCCCACGGTCTTGCGCATGGTGATGCGG
CCCTCGCCGAAGGAACCCACCTTGATGGGGGTGCCGGCCATCGCCGTGGAGGAGATCGCCATGGTGGAGGCAGCCATTGCTGAAGCTGAGCGTGAAAGTG
TTGGACCGGTTGCTATAGATGCCGCTGGT