Detailed information on CNT30135675


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697144Lolium perenneOryza sativa44.8520.9490.59170forward
CNT30184672Lolium perenneSecale cereale37.4743.0396.48142forward
CNT30297056Lolium perenneTriticum aestivum46.4451.4696.02176forward
CNT30390869Lolium perenneTriticum turgidum41.9533.8396.23159forward
CNT30438779Lolium perenneAegilops tauschii94.7256.8988.02359forward
CNT30249379Lolium perenneAvena sativa47.7645.5997.79181forward
CNT30662842Lolium perenneTriticum dicoccoides45.6530.9595.95173forward
CNT30371307Lolium perenneOryza glumipatula44.5915.690.53169forward
CNT30322408Lolium perenneAsparagus officinalis38.5216.884.25146forward
CNT30104243Lolium perenneOryza rufipogon45.1231.6790.64171forward
CNT30578138Lolium perenneOryza barthii45.1220.3890.64171forward
CNT30117952Lolium perenneOryza nivara44.3313.5290.48168forward
CNT3039554Lolium perenneMarchantia polymorpha25.3326.2391.6796forward

Expression of CNT30135675

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MFLLALIIYTHGHIRTLDTFPGKINTAHHAALHACS*

>peptide 2 (46 aa)
MKKPSMENMARRPFLISFTLSSAAWSGSVARPRGSNGPPGWSLSSKS

>peptide 3 (29 aa)
MQLIIDKATAADELAINGELTGSRRGPGR*

Sequence

>CNT30135675
AGCACTGCTGGAGAGGTATAAGAAATCAGAAAGATCATGTTTCTTCTGGCCTTGATAATTTACACGCACGGGCACATCCGTACTCTTGATACTTTTCCCG
GTAAAATTAACACAGCGCATCATGCTGCATTGCACGCATGCAGCTGATCATCGACAAAGCGACGGCGGCGGACGAACTGGCAATTAACGGCGAGCTCACA
GGTTCTCGTAGGGGCCCTGGCCGGTGACGTAGGCCTGGATGAAGAAACCCAGCATGGAGAACATGGCCAGGCGTCCGTTCTTGATCTCCTTCACCTTGAG
CAGCGCCGCCTGGTCGGGGTCGGTGGCGAGGCCGAGAGGGTCGAATGGGCCGCCGGGGTGGAGCTTGTCATCGAAGTCC