Detailed information on CNT30135610


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONGMAT000778, E-value = 4e-42

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674834Lolium perenneSetaria viridis42.0855.5490.73356forward
CNT30316236Lolium perenneCorylus avellana16.7830.9488.03142forward
CNT30547574Lolium perenneIpomoea triloba19.7447.0487.43167forward
CNT30512729Lolium perenneJuglans regia42.234.6982.63357forward
CNT30372016Lolium perenneArabidopsis thaliana18.9142.985.62160forward
CNT30276060Lolium perenneChenopodium quinoa16.922.5686.71143forward
CNT30379936Lolium perenneManihot esculenta24.9463.1786.26211forward
CNT30405823Lolium perenneBeta vulgaris27.952.4481.78236forward
CNT30488117Lolium perenneOlea europaea29.0850.4183.33246forward
CNT30711584Lolium perenneGlycine max25.0630.1185.38212forward
CNT30191304Lolium perenneSecale cereale49.8832.4492.42422forward
CNT30300473Lolium perenneTriticum aestivum31.0927.1793.54263forward
CNT30224354Lolium perenneHordeum vulgare33.4554.5391.87283forward
CNT30395070Lolium perenneTriticum turgidum50.4755.8291.1427forward
CNT30561656Lolium perenneActinidia chinensis47.428.6481.3401forward
CNT30510505Lolium perenneSolanum lycopersicum25.319.7188.32214forward
CNT30552635Lolium perenneOryza glaberrima46.5737.9689.09394forward
CNT30440874Lolium perenneAegilops tauschii40.6670.4991.28344forward
CNT3014085Lolium perenneZea mays23.0531.9790.77195forward
CNT3041882Lolium perenneChlamydomonas reinhardtii21.2817.8979.44180forward
CNT30605685Lolium perenneGossypium raimondii29.232.3385.83247forward
CNT30684236Lolium perenneTriticum urartu50.4751.9590.4427forward
CNT30722731Lolium perenneTriticum spelta25.6542.4782.03217forward
CNT30345702Lolium perenneEragrostis tef25.1826.3682.63213forward
CNT30361520Lolium perenneSorghum bicolor25.7731.8783.94218forward
CNT30596122Lolium perenneOryza meridionalis27.1933.2489.13230forward
CNT30359537Lolium perenneLactuca sativa23.2929.8979.19197forward
CNT30369654Lolium perenneOryza glumipatula41.614088.64352forward
CNT30107537Lolium perenneOryza longistaminata28.2526.0187.45239forward
CNT30100253Lolium perenneOryza rufipogon50.4738.7589.23427forward
CNT30575129Lolium perenneOryza barthii29.9131.0888.54253forward
CNT30497701Lolium perenneDigitaria exilis31.0980.9292.4263forward
CNT30116094Lolium perenneOryza nivara45.8644.0989.18388forward
CNT30604019Lolium perenneOryza punctata22.2255.6291.49188forward
CNT3050899Lolium perenneCucumis sativus6.3821.4390.7454forward

Expression of CNT30135610

Peptides detected in this lncRNA

>peptide 1 (75 aa)
MTGRTTSQTSKQMPRMFSSASAPSFDAHWKPATTESLISFRYCTPLHMSTTMFGPVVSGPKHQIFLARSLSHPNS*

Sequence

>CNT30135610
GCACCAAGAATTACTAGCGGACGACAGATACATAAATCTAAGTTTTAACATCTGTTACATCACGACAGACAGCAAAACATAGTCTCAGGCTCTCAGCCCA
CTACCAATACCACGACAGATAGTTCATTACGATACAAGACGACTCAATGAAAATAAAGCAGTTCTCATAGTAAGATAGAAAATGCAGCAAAACATGACCC
CAGAAACTTAGAGCTTGTCCTCGAAGTCAGAGAGAGGAGTCATCTGTTCCTTGAGCCCCTTCCTCTTGCGGATATCCTTGACGAGGTTGAAAGACTGGGA
GTCCACCTCCAGAGGATCAGAGTTCATCACTTCCCAGTGGTCAAACACACACTGGGGGAAGGCCTGGCCAGATGTTGCGGCCCTGAGGGTGGCCGAGAAA
CCAAACGACTCAATGACAGGGAGGACAACATCACAGACCTCAAAGCAGATGCCACGCATGTTCTCGTCAGCCAGTGCACCTTCCTTCGATGCCCACTGGA
AGCCAGCAACAACAGAGTCCTTGATCTCATTCAGGTACTGCACTCCCTTACACATGTCAACAACCATGTTCGGGCCTGTGGTCTCAGGTCCAAAGCACCA
AATCTTCTTGGCGAGATCCTTGTCCCACCCAAACTCCTGAGAGAGGATCTGGGAGCGCACCTTAGGATCATCACGTGGGCCAATGCGTCCCTCATCAATG
GCCTCAGGCAATCCCTCTTCCAATGGGCGGGCCTCCATGTAAAGACGGTTGTGCTTGTTAGGGGACTTGCTCATAACAGTACGGCATGACTTGTCAAGAA
CAGTCTCTCGGAAGGAGACAACAGGTGGGGAAACAATAATTTCAGC