Detailed information on CNT30135596


BLAST search results

BLAST vs Swiss-Prot:
sp|Q76H85|H4_SILLA, E-value = 6e-41

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30549690Lolium perenneIpomoea triloba50.1344.5286.1187forward
CNT30300261Lolium perenneTriticum aestivum74.2657.8394.95277forward
CNT30220695Lolium perenneHordeum vulgare42.936.796.88160forward
CNT30394714Lolium perenneTriticum turgidum74.2663.196.03277forward
CNT30565712Lolium perenneActinidia chinensis55.2368.984.95206forward
CNT30435093Lolium perenneAegilops tauschii76.1455.895.77284forward
CNT30256161Lolium perenneAvena sativa77.4858.0396.89289forward
CNT30664872Lolium perenneTriticum dicoccoides74.2658.9495.31277forward
CNT30620798Lolium perenneCajanus cajan40.7529.1284.87152forward
CNT30148852Lolium perenneBrachypodium distachyon66.2255.6393.93247forward
CNT30101875Lolium perenneOryza rufipogon74.838.793.19279forward
CNT30581397Lolium perenneEchinochloa crusgalli74.2647.1992.06277forward

Expression of CNT30135596

Peptides detected in this lncRNA

>peptide 1 (30 aa)
PMNETLPDLKHQTSRREHPRNLLEAQPPKP*

>peptide 2 (55 aa)
MSPEMRFTPPRRARRRMAGLVMPWMLSRRTFRWRLAPPLPRPLPPLPRPDIADDGR

Sequence

>CNT30135596
CCCCAATGAACGAAACTCTACCAGATCTAAAGCATCAGACATCCAGGAGAGAACACCCTAGGAATCTTCTTGAGGCTCAGCCTCCGAAGCCGTAGAGGGT
GCGTCCCTGGCGCTTGAGGGCGTAGACGACGTCCATGGCGGTGACGGCGTCGCGGATGACGTTCTCGAGGAAGATCTTGAGCACGCCGCGGGTCTCCTCG
TAGATGAGCCCGGAGATGCGCTTCACGCCGCCACGGCGAGCAAGGCGGCGGATGGCCGGCTTGGTGATGCCCTGGATGTTGTCGCGGAGGACCTTCCGGT
GGCGCTTGGCGCCGCCCTTGCCGAGACCCTTGCCTCCCTTGCCGCGGCCCGACATTGCTGACGATGGGAGGAG