Detailed information on CNT30133578


BLAST search results

BLAST vs Swiss-Prot:
sp|P27523|CB23_HORVU, E-value = 2e-154

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30454234Lolium perenneSaccharum spontaneum66.3882.4389.84610forward
CNT30580752Lolium perenneEchinochloa crusgalli67.4677.3189.35620forward

Expression of CNT30133578

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MACTKNPNMENMARRPFLISLTLSSAKYWPPG*

>peptide 2 (34 aa)
MRDRTKKSLRFLNSENNSRDHCLQFACMTLDKQE*

>peptide 3 (70 aa)
MDEVGVPEVVEAAVGEDLRAGLEPDGLLELDAHPLLEHLGEDAAERAEHGPPAVDDLERPVPGEGLRVGG*

>peptide 4 (29 aa)
MAHRPWMTSSALFLAKASGSADSPAVSQP*

>peptide 5 (31 aa)
MRNPSTRPMSRTWKPSTARMLCAWTRLGFPR*

Sequence

>CNT30133578
GTATGCATTTTGCTGAATTTCACATCCAGTTCTTCTCATCAGTTATTACACGTCTCCATACTTGATACAATGCACGCATAGCCAACAAGAATCAGCTAAG
CACACCATATAGTAAGTTGACAGACATGAGAGATCGAACCAAAAAATCCTTGAGATTTCTGAATTCTGAGAACAATTCAAGAGACCATTGTTTGCAATTT
GCGTGCATGACACTCGACAAACAAGAGTAGTTTACACTTTACAAGCGGCGGGGCGCCGTGCTGCGTCGACCGGTCCACGACTTAAGAGCCAGGAGCGAAC
TTGGTGGCGAAAACCCAGGCATTGTTGGCGACAGGGTCGTCGAGGTGGTCGAAGAGGTTCTCCAACGGGCCCTTGCCGGTGACGATGGCTTGCACGAAAA
ACCCAAACATGGAGAACATGGCGAGGCGTCCATTCTTGATCTCCTTGACCTTAAGCTCTGCGAAGTACTGGCCGCCGGGGTAGAGGTCGTTGCCCTCGCC
AACGCCGTCGAGGCCGTTGATGCGGAATCCCTCGACGAGGCCCATGAGCAGGACCTGGAAGCCGAGCACGGCGAGGATGCTCTGCGCATGGACGAGGTTG
GGGTTCCCGAGGTAGTCGAGGCCGCCGTCGGAGAAGATCTGCGAGCCGGCCTTGAACCAGACGGGCTCCTTGAACTCGACGCCCACCCACTTCTGGAGCA
CCTCGGGGAAGACGCAGCCGAGCGCGCCGAGCATGGCCCACCGGCCGTGGATGACCTCGAGCGCCCTGTTCCTGGCGAAGGCCTCCGGGTCGGCGGATAG
CCCGGCGGTGTCCCAGCCGTAGTCGCCGGGGAACTCGCCGTTGAGGTACGACGGCGTCTGCGCGGAGAAAGGGCCCAGGTACTTGACGCGATCCGGGCCG
TACCACAAGTCGTTGCCCT