Detailed information on CNT30133575


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9XF88|CB4B_ARATH, E-value = 6e-16

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671670Lolium perenneSetaria viridis11.7920.9597.3375forward
CNT30640430Lolium perenneNymphaea colorata16.8223.3189.72107forward
CNT30179479Lolium perenneSecale cereale38.3635.2692.62244forward
CNT30288841Lolium perenneTriticum aestivum38.3644.8592.62244forward
CNT30387274Lolium perenneTriticum turgidum38.2154.2492.59243forward
CNT30436081Lolium perenneAegilops tauschii50.3162.6284.69320forward
CNT3013737Lolium perenneZea mays17.4523.8289.19111forward
CNT30680618Lolium perenneTriticum urartu38.2125.2992.18243forward
CNT30338965Lolium perenneEragrostis tef15.5731.5391.9299forward

Expression of CNT30133575

Peptides detected in this lncRNA

>peptide 1 (86 aa)
MSVPSRYSGACAPGNHSGRSVVGGALDFFGGAFFLPKPKPKRATMRPFCGAGSARRVPRKVLAAAATDEAMATLAHSLSSSAFAWIE

>peptide 2 (37 aa)
MVVCSGSLRWVAQLLRGPLPVAAACTAKPRKPKGSNP*

>peptide 3 (76 aa)
GCIRSPLVHILQISKSQQLSYVIRPALINKGSFAVLSLIARHTKRNHVLTRTRSSIFAAELTEAYTLLDDRDRPRA*

Sequence

>CNT30133575
GTGGATGCATTAGGTCACCATTGGTTCATATTTTACAAATCTCCAAGTCCCAGCAGCTGTCCTATGTAATCAGACCTGCATTAATCAACAAAGGATCTTT
TGCGGTACTCTCTCTCATCGCTCGTCACACAAAACGAAACCACGTTCTTACAAGGACGCGTTCGTCCATTTTTGCAGCCGAGCTGACAGAAGCGTATACA
CTGCTCGACGACCGAGACCGGCCGCGCGCTTAAGAGGAGCCGAGGGTGTCGAAGATGGTGGTGTGCAGCGGGTCGCTGAGGTGGGTGGCCCAGTTGTTGA
GGGGGCCCTTGCCGGTGGCGGCGGCCTGCACGGCGAAGCCGAGGAAGCCGAAGGGGTCGAACCCGTAGTCGCCGATGAGCGTGCCGTCGAGGTACTCGGG
CGCCTGCGCGCCGGGGAACCACAGCGGCCGGTCGGTGGTCGGTGGTGCCTTGGACTTCTTCGGCGGCGCCTTCTTCTTGCCCAAGCCGAAGCCGAAGCGC
GCCACGATGCGCCCGTTCTGCGGCGCCGGGTCCGCGAGGCGGGTCCCGAGGAAGGTGCTCGCCGCCGCAGCCACCGACGAAGCCATGGCAACTCTAGCTC
ACTCCTTGTCCTCCTCGGCCTTTGCGTGGATTGAGG