Detailed information on CNT30133569


BLAST search results

BLAST vs Swiss-Prot:
sp|P36494|CB4_SPIOL, E-value = 1e-63

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676633Lolium perenneSetaria viridis37.1549.592.8250forward
CNT30523802Lolium perenneSetaria italica38.1941.7992.61257forward
CNT30288331Lolium perenneTriticum aestivum33.5826.1393.81226forward
CNT30436497Lolium perenneAegilops tauschii38.0440.8994.14256forward
CNT30244062Lolium perenneAvena sativa29.1243.3697.45196forward
CNT30657766Lolium perenneTriticum dicoccoides38.0438.5594.92256forward
CNT30464459Lolium perenneSaccharum spontaneum37.1528.5494.8250forward
CNT30346728Lolium perenneEragrostis tef22.5926.7694.74152forward
CNT30366227Lolium perenneSorghum bicolor22.1421.7297.99149forward
CNT30585419Lolium perenneEchinochloa crusgalli38.1926.5593.39257forward
CNT30498257Lolium perenneDigitaria exilis38.1928.0693.39257forward

Expression of CNT30133569

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MQQSIASDQLMQMQQPSPPTTRAYRVPNCRL*

>peptide 2 (31 aa)
MPSTAAIAHRPWISSASLYHLRNAGSLPRPRG

>peptide 3 (71 aa)
MKYRCSFCLELQNQDCSYITWYIHWDETKRVLLDSPFDSHNTPPERSHGHTDTLLLLLRPNPCSNPSRPIS*

Sequence

>CNT30133569
TGTTCTAGTAAAAGACTAGTACGAAGATGATCAATGAAATATCGTTGCTCATTCTGCCTTGAATTACAGAACCAAGACTGCTCATATATTACATGGTACA
TACACTGGGACGAAACAAAGAGAGTACTCCTTGATTCCCCATTTGATTCACACAACACACCACCCGAAAGAAGTCACGGACACACAGATACATTGCTGCT
TCTTCTTCGGCCGAACCCATGCAGCAATCCATCGCGTCCGATCAGCTGATGCAAATGCAGCAGCCCTCACCACCCACCACGCGCGCGTACCGAGTTCCTA
ACTGTAGATTATAGGCCGAGCGCGCCGAGCGGCGTCTTGCCCTGTCCGGCCTCGAAGTAGAAGATGAGCATGGCGAGCATGGCGAGGCGCGCGTGCTTGA
TCTCTGCGAGCTTGAGCCGCTCGAGCTTGTCGGCGTCGGGGATGTAGACGCCGTCCTTGGTGTCGCCGCCGAGGCCGAGCGGGTCGAAGAACTTGCCGCC
GGGGTACCCTTGCTCGCCGGTGGAGTTGGAGAAGTTCTCGGCGGTGCGCGACCATGGCGTGGCCTGCCCGACGAAGATGCCCAGCACGGCCGCCATCGCC
CACCGCCCGTGGATCAGCTCCGCCTCCCTGTACCACTTGAGGAACGCCGGGTCCTTGCCCAGGCCAAGAGGGT