Detailed information on CNT30133198


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676468Lolium perenneSetaria viridis35.787.7790.3683forward
CNT30523847Lolium perenneSetaria italica65.9515.2892.81153forward
CNT30524805Lolium perennePhaseolus vulgaris254.8187.9358forward
CNT30221685Lolium perenneHordeum vulgare68.130.6295.57158forward
CNT30436771Lolium perenneAegilops tauschii28.8812.2795.5267forward
CNT30244006Lolium perenneAvena sativa2514.2298.2858forward
CNT30231796Lolium perenneAnanas comosus64.6639.7987.33150forward
CNT30215929Lolium perenneHelianthus annuus23.285.7390.7454forward
CNT30680437Lolium perenneTriticum urartu63.7928.4194.59148forward
CNT30353979Lolium perenneEragrostis tef2521.3294.8358forward
CNT30365811Lolium perenneSorghum bicolor65.5223.6890.79152forward

Expression of CNT30133198

Peptides detected in this lncRNA

>peptide 1 (76 aa)
PNFWSRTLTKGARQLVVQEVGRLLHAAGVVDGDDLERRAVAAPVPATQEVAPDAAEPVDRHLQLCLRRRLVAAAGAN

>peptide 2 (40 aa)
MAMTSSGELSPRPCQQRRKLRPMRPNPLIATFSFASVGAL*

>peptide 3 (29 aa)
ELLVEDLDEGCEAVGGAGGGTPASRRRCR*

Sequence

>CNT30133198
CCGAACTTTTGGTCGAGGACCTTGACGAAGGGTGCGAGGCAGTTGGTGGTGCAGGAGGTGGGACGCCTGCTTCACGCCGCCGGTGTCGTTGATGGCGATG
ACCTCGAGCGGCGAGCTGTCGCCGCGCCCGTGCCAGCAACGCAGGAAGTTGCGCCCGATGCGGCCGAACCCGTTGATCGCCACCTTCAGCTTTGCCTCCG
TCGGCGCCTTGTAGCCGCCGCTGGTGCTAACC