Detailed information on CNT30132965


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692141Lolium perenneOryza sativa54.0336.9694.76248forward
CNT30317088Lolium perenneCorylus avellana39.8725.0380.87183forward
CNT30616476Lolium perenneSesamum indicum40.5237.583.87186forward
CNT30589607Lolium perenneMusa acuminata52.7261.7387.19242forward
CNT30552977Lolium perenneOryza glaberrima60.3541.3493.86277forward
CNT301476Lolium perenneZea mays20.728.9690.5395forward
CNT30231426Lolium perenneAnanas comosus58.1734.0186.52267forward
CNT30345256Lolium perenneEragrostis tef60.3553.8991.34277forward
CNT30595924Lolium perenneOryza meridionalis57.9554.9693.61266forward
CNT30101081Lolium perenneOryza rufipogon61.6623.2393.64283forward
CNT30116289Lolium perenneOryza nivara61.6636.1993.64283forward
CNT30113588Lolium perenneFicus carica40.9629.7982.98188forward

Expression of CNT30132965

Peptides detected in this lncRNA

>peptide 1 (31 aa)
VIQRPALTLMNQKPILLAIELLLLAIVQHQE*

>peptide 2 (54 aa)
DTTAGINTDESEAHTTSHRTLIASHSTTSRIVLVTRGGHPPAGIDAVVVVVASW*

Sequence

>CNT30132965
GTGATACAACGGCCGGCATTAACACTGATGAATCAGAAGCCCATACTACTAGCCATCGAACTCTTATTGCTAGCCATAGTACAACATCAAGAATAGTACT
CGTAACTCGTGGTGGGCACCCGCCAGCCGGTATAGATGCAGTAGTAGTAGTAGTAGCTAGTTGGTGAAGTTGTTGAGGTAGAAGGTGTAGAAGATCTTGA
AGGGGAAGACGATCTGGTTGAGCTTGACCTGTCCGTATGCGCCCTCGAAGACGCCGGAGCCACCGGTGACGGCGAGGTAGGACTCCTCGTAGGTGAGGTA
TGGGCCCTGCACGGTGAGGTGGCCGTAGTCGCCGAAGTAGATGCTGTAGATGGCCTCGTAGCGATCCCCGTTGCGCTCCGGCACGTGCTGGATGAGGATG
CAGATCCCCGCCGTGATCCCGATCCGCTTGTCCAGGCTCCCGTTGTACACCTGCAGCAG