Detailed information on CNT30132437


BLAST search results

BLAST vs Swiss-Prot:
sp|Q40034|EF1A2_HORVU, E-value = 0.0

BLAST vs NONCODE:
NONBNAT001751, E-value = 2e-174

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692364Lolium perenneOryza sativa73.7178.6987.81886forward
CNT30672814Lolium perenneSetaria viridis58.465.8586.61702forward
CNT30520765Lolium perenneSetaria italica73.9643.7587.74889forward
CNT30639730Lolium perenneNymphaea colorata48.8463.8781.09587forward
CNT30535563Lolium perenneEucalyptus grandis66.6498.1682.15801forward
CNT30316757Lolium perenneCorylus avellana58.3258.5184.02701forward
CNT30546799Lolium perenneIpomoea triloba72.0570.5281.87866forward
CNT30518094Lolium perenneJuglans regia72.8893.5981.51876forward
CNT30371709Lolium perenneArabidopsis thaliana51.1695.585.53615forward
CNT30274113Lolium perenneChenopodium quinoa36.3670.0382.61437forward
CNT3021028Lolium perenneCitrullus lanatus66.5664.4180.88800forward
CNT30727590Lolium perenneCorchorus capsularis71.9663.8482.77865forward
CNT30380230Lolium perenneManihot esculenta73.1336.2381.8879forward
CNT30629687Lolium perenneVigna unguiculata26.6216.286.25320forward
CNT30194937Lolium perennePisum sativum25.9631.2385.9312forward
CNT30160120Lolium perennePistacia vera73.7171.2884.09886forward
CNT30287202Lolium perenneTriticum aestivum39.6866.3489.52477forward
CNT30224132Lolium perenneHordeum vulgare35.7762.6886.98430forward
CNT30387246Lolium perenneTriticum turgidum73.8877.1589.19888forward
CNT30564257Lolium perenneActinidia chinensis5052.4483.53601forward
CNT3084148Lolium perenneVigna radiata48.2535.681.38580forward
CNT30541590Lolium perenneBrassica napus73.0475.4983.83878forward
CNT30233993Lolium perenneBrassica oleracea73.0481.7583.6878forward
CNT30173274Lolium perenneTrifolium pratense69.8862.4582.26840forward
CNT30146334Lolium perenneMedicago truncatula51.5862.3781.45620forward
CNT30440628Lolium perenneAegilops tauschii29.4548.2388.98354forward
CNT30248159Lolium perenneAvena sativa92.18101.1989.981108forward
CNT30665783Lolium perenneTriticum dicoccoides70.1392.5486843forward
CNT30310418Lolium perenneCamelina sativa72.8875.5284.82876forward
CNT3059230Lolium perenneArabidopsis lyrata73.0473.0484.85878forward
CNT3077042Lolium perenneBrassica juncea73.0472.9284.85878forward
CNT30614135Lolium perenneArabis alpina62.3148.0184.65749forward
CNT30598511Lolium perenneFraxinus excelsior40.0273.8983.16481forward
CNT30449495Lolium perenneSaccharum spontaneum73.2172.3186.25880forward
CNT3011166Lolium perenneZea mays73.6362.5986.44885forward
CNT30647369Lolium perenneRosa chinensis23.2930.9185.71280forward
CNT30685098Lolium perenneTriticum urartu43.5935.6589.31524forward
CNT30721809Lolium perenneTriticum spelta23.7918.9587.06286forward
CNT30350898Lolium perenneEragrostis tef73.1378.987.26879forward
CNT30480841Lolium perenneArabidopsis halleri33.0363.9385.39397forward
CNT30368495Lolium perenneSorghum bicolor60.9871.9386.22733forward
CNT30355521Lolium perenneLactuca sativa50.563.6384.18607forward
CNT30427598Lolium perennePapaver somniferum72.363.5282.28869forward
CNT30706337Lolium perennePrunus avium69.8872.0483.81840forward
CNT3024873Lolium perennePopulus trichocarpa31.4567.0284.92378forward
CNT3037774Lolium perenneCucumis melo38.9460.5484.83468forward
CNT30148140Lolium perenneBrachypodium distachyon30.3796.0587.4365forward
CNT30101053Lolium perenneOryza rufipogon27.2939.4791.16328forward
CNT30580076Lolium perenneEchinochloa crusgalli32.5329.5586.96391forward
CNT30496874Lolium perenneDigitaria exilis73.5478.8687.22884forward
CNT30116111Lolium perenneOryza nivara25.8735.5490.68311forward
CNT30594443Lolium perenneEragrostis curvula73.7176.3187.36886forward
CNT30603820Lolium perenneOryza punctata73.5481.9387.33884forward
CNT30176122Lolium perenneVigna angularis70.8875.2779.69852forward
CNT30113122Lolium perenneFicus carica38.9456.3984.4468forward
CNT30724026Lolium perenneLupinus angustifolius69.8858.3382.62840forward
CNT3050294Lolium perenneCucumis sativus37.0272.5982.47445forward

Expression of CNT30132437

Peptides detected in this lncRNA

>peptide 1 (93 aa)
MMMTWATKLAASLAGSSLALEATYPRLISFTATFLTLKPTLSPGPASSIDSWCISTDLTSVVSPVGPKVTSWPGLITPVSTRPTGTVPMPPIL*

>peptide 2 (72 aa)
MSRTAKRPRGGYWAKVSTTMGLVGIIFTKPASPFLRNLGKASISLPDRLSTLVWISENLTAMWEVWQSSTGA*

>peptide 3 (46 aa)
MGPCQGCSRPSSGMRRLPSRFPRNGPWSTWGWWHPSTKNRTSTLVSK

Sequence

>CNT30132437
GGCAGAGATATTAAGAATCACACAGTAAACTCAGACAAAATAATATGACTCCAAATTTCTGACCTGCTATATATAAAGTAGCAACTGTAACCGAACATAG
CATGCCAATAGTTCACCAACACAAACAGAAGATAGAATGATAAGCAGCACAAAGGCTGCTCGACGCGCACATAACCAAACTCGACAAAACGGGGCAAGTT
CCCAAACACACTAACACTCCTAACATCACGATATACCACCACCACTACTGCGGGTGTAGTAGCAGACAACCACCAGGCATCATCTCATTTCTTCTTGGCG
GCAGCCTTGGTCACCTTGGCGCCAGTGGGATCCTTCTTCTCCACGCTCTTGATCACACCAACAGCGACGGTCTGCCTCATGTCGCGCACAGCAAAGCGAC
CAAGGGGAGGGTACTGGGCGAAGGTCTCCACCACCATGGGCTTGGTGGGAATCATCTTCACGAAACCAGCATCACCGTTCTTGAGGAACTTGGGGAAGGC
CTCAATCTCCTTACCAGATCGCCTGTCAACCTTGGTCTGGATCTCAGAGAACTTGACGGCGATGTGGGAGGTGTGGCAGTCCAGCACTGGGGCGTAGCCG
TTGCCGATCTGACCAGGGTGGTTCATGATGATGACCTGGGCAACGAAGCTGGCAGCCTCCTTGGCGGGGTCGTCCTTGGCATTGGAGGCCACGTACCCAC
GCTTGATATCCTTCACAGCAACATTCTTGACGTTGAAGCCAACATTGTCACCTGGCCCAGCCTCAAGCATAGACTCGTGGTGCATCTCCACAGACTTGAC
CTCAGTGGTCAGCCCAGTTGGGCCAAAGGTGACGAGCTGGCCAGGCTTGATCACACCTGTCTCAACACGCCCCACCGGCACAGTTCCAATGCCACCAATC
TTGTAAACGTCCTGGAGGGGAAGACGCAGGGGCTTGTCCGAGGGCCTCTTGGGCTCATTGATCTGGTCAAGAGCCTCAAGGAGGGTGGGGCCCTTGTACC
AGTCAAGGTTGGTGGACCTCTCAATCATGTTGTCACCCTCAAACCCAGAGATGGGGACAAATGGGACCTTGTCAGGGTTGTAGCCGACCTTCTTCAGGTA
TGAGGAGACTTCCTTCACGATTTCCTCGTAACGGCCCTTGGAGTACTTGGGGGTGGTGGCATCCATCTACAAAGAACAGAACAAGCACATTAGTTTCAAA
GA