Detailed information on CNT30131917


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30180157Lolium perenneSecale cereale38.2443.1385.16182forward
CNT30346474Lolium perenneEragrostis tef33.1926.6992.41158forward

Expression of CNT30131917

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MGGRGGARGPCRTGTTRSRAGRRCRQRRTCPRRGRARRGRRGRGAR*

>peptide 2 (74 aa)
MPSTSDLPSAGKGASGKTRSRRAVTSAGHFPTTCFRMISPLVRNPCRHRNLGRLATTPPPPAPRLPILPIGGGVV

>peptide 3 (77 aa)
KYMTEKITNSQIRTFDILGRRKQEERIKNQKRATDSTQIPFLEDELTDQDMRAMRWCEARDGREGRRARTLSNWNHS*

Sequence

>CNT30131917
AAAATATATGACGGAGAAAATAACCAATAGTCAAATACGCACGTTCGACATCCTGGGGAGAAGAAAACAGGAGGAGCGGATAAAAAACCAAAAACGTGCT
ACGGACTCCACCCAAATTCCTTTTTTAGAGGACGAATTGACAGATCAGGACATGAGAGCAATGCGGTGGTGCGAGGCGAGGGATGGGAGGGAGGGGAGGC
GCGCGCGGACCTTGTCGAACTGGAACCACTCGTAGTAGGGCGGGTCGAAGATGCCGTCAACGTCGGACTTGCCCTCGGCGGGGAAGGGCGCGTCGGGGAA
GACGAGGTCGAGGCGCGCGGTGACCTCGGCGGGCCACTTCCCCACCACCTGCTTCCGCATGATCTCGCCGCTGGTCCGGAACCCGTGCAGGCACAGGAAC
CTCGGCCGCCTGGCGACCACCCCTCCGCCGCCGGCGCCGAGGCTGCCCATCCTGCCAATTGGAGGAGGAGTTGTTC