Detailed information on CNT30131530


BLAST search results

BLAST vs Swiss-Prot:
sp|P12331|CB22_ORYSJ, E-value = 7e-149

BLAST vs NONCODE:
NONBNAT002216, E-value = 1e-48

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30188309Lolium perenneSecale cereale68.3880.8187.32560forward
CNT30129614Lolium perenneCorymbia citriodora33.8233.8291.7277forward
CNT30103422Lolium perenneOryza rufipogon73.0246.1186.62598forward
CNT30117570Lolium perenneOryza nivara65.8151.6387.38539forward
CNT3063784Lolium perenneSelaginella moellendorffii63.2545.1684.56518forward

Expression of CNT30131530

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MENMARRPFLSSFTLSSANASGSSARPSGSKLPPGYSGSMISPNGPPAMR*

>peptide 2 (29 aa)
MAHREWITSSSRFLAKVSGSAESPAVSHP*

Sequence

>CNT30131530
TGACATATAGTTTTAGTTAGTTATCTGGACGAGTTGCTCCATCACCAGTATTTACATGAAAGAGCGGGCAACAAATAGTATCCTGGACTAATATGCCTGA
CTTACCAAATTACGAACGCTTTTTCATAGGATCGTCATAATTTACATTGTGGTAGTACAATTCAAACTGCGCCTAGGCACAACCATCTTCCAGCTGACGC
CGGCAGATCACTTTCCGGGTACAAAGTTGGTGGCAAATGCCCAAGCATTGTTGTTGACAGGGTCGGCCAGGTGATCAGCGAGGTTTTCGAGCGGGCCCTT
ACCAGTGACGATGGCCTGAACGAAGAAGCCGAACATGGAGAACATGGCAAGACGTCCGTTCTTGAGCTCCTTCACCTTGAGCTCCGCGAACGCCTCAGGG
TCGTCGGCTAGGCCAAGCGGGTCGAAGCTACCGCCAGGGTACAGCGGGTCGATGATCTCCCCCAATGGTCCACCAGCAATGCGGTAGCCCTCAACGGCGC
CCATGAGCACAACCTGGACGGCCCATATGGCGAGGATGCTCTGGGCGTGGACGAGGCTCGGGTTTCCGAGGTAGTCAAGGCCTCCTTCGCTGAAGATCTG
GGAGCCGGCCTTAAACCACACAGCCTCGCCGAACTTAACGCCGTTGCGGGCGAGCAGCTCGGGAAAGACGCAACCGAGCGCACCGAGCATGGCCCACCGA
GAGTGGATCACCTCGAGCTCCCGATTCTTGGCAAAGGTCTCGGGGTCGGCCGAGAGTCCGGCGGTGTCCCACCCGTAGTCACCGGGAAACTCGCCGGTCA
GGTAGCTTGGCGGCTCCCC