Detailed information on CNT30131449


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6AUG0|U2AFB_ORYSJ, E-value = 1e-102

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30626282Lolium perenneDaucus carota10.7632.9385.1981forward

Expression of CNT30131449

Peptides detected in this lncRNA

>peptide 1 (54 aa)
HGSHLHHHLHGNHHHHDHHGGSHHRDHGCLSCSVGLGCGFSRGSSWNAPHTASS*

>peptide 2 (92 aa)
TVATFTTTSTVTTTITTITAEVTTAITVVSPVLWAWAAASPVAPPGTPPIQLPPKLSANLLHMHEITVATTVAAVLLILPTGEYSTIIGRPE*

Sequence

>CNT30131449
CACGGTAGCCACCTTCACCACCACCTCCACGGTAACCACCACCATCACGACCATCACGGCGGAAGTCACCACCGCGATCACGGTTGTCTCTCCTGTTCTG
TGGGCTTGGGCTGCGGCTTCTCCCGTGGCTCCTCCTGGAACGCCCCCCATACAGCTTCCTCCTAAGCTCTCTGCCAATCTGCTTCACATGCATGAAATTA
CAGTAGCCACCACGGTTGCAGCTGTTCTCCTCATACTGCCTACAGGGGAGTACTCCACAATAATAGGGCGGCCAGAGTAAAAGCGGCCCTGAAGGGCATT
GTGAGCAGCCACTGCCTGCTCTTCCTCCCTGAACTGGACATAGACATTGCCAATCATGTGGTCAGCAAGGTTGTCACATACATTCAGGGTCTCAACCTCA
CCAAACTTGCTCAGCTCCTCGTAGATGTCCTCATAGAAGTCCTCAAAGTGCTCCTGCATCTTCTCAGGAGCAATAGCCTGGCCTTGGGCATCAACTCCAG
GGGTGATCATATCAGGTCGCTGATACATGTTAGCAAGCACAATAGTTGGTGATGTGGTTGGCCTGTTGTGCAGACGGGAGCAACGATCCCCATGACGGCA
AGCTCCAATCTTGAAGTAAAAGGGGCAGTTGACCCTGTCCTTCTCAGTGCCAAATATTGAAGCCAAGTGCTCCGCCATGGTTTTGAGAGCACTTCAGGGC
ACGCACCTCGGGAGCGAAGAACCGCGGCGCTTTCGACGATCGATCCTGCGGGC