Detailed information on CNT30131011


BLAST search results

BLAST vs Swiss-Prot:
sp|Q42850|PORB_HORVU, E-value = 3e-47

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678552Lolium perenneSetaria viridis25.245.4389.61154forward
CNT30522232Lolium perenneSetaria italica36.3322.2792.34222forward
CNT30640181Lolium perenneNymphaea colorata18.1722.8984.68111forward
CNT30679064Lolium perenneTriticum urartu38.7925.3296.62237forward
CNT30497116Lolium perenneDigitaria exilis36.522.6492.38223forward
CNT30113199Lolium perenneFicus carica16.0422.4883.6798forward

Expression of CNT30131011

Peptides detected in this lncRNA

>peptide 1 (32 aa)
CWKKLKTCKCICSVWPPKDTLLSLLPNQIKKN*

>peptide 2 (29 aa)
VVGRNSKRANAFAVFGRPKTLYCHYYQIK*

>peptide 3 (41 aa)
LLEETQNVQMHLQCLAAQRHFIVTITKSNKKELVLQAYTHL*

>peptide 4 (36 aa)
MITPDSVGRGHIRRTYRFFLPKVSYTYSFLFSIFLG*

Sequence

>CNT30131011
GTTGTTGGAAGAAACTCAAAACGTGCAAATGCATTTGCAGTGTTTGGCCGCCCAAAGACACTTTATTGTCACTATTACCAAATCAAATAAAAAAGAACTA
GTTTTACAGGCTTACACTCACTTATGATCACTCCTGACTCAGTTGGGCGTGGCCACATAAGAAGAACCTACCGGTTTTTTTTGCCAAAGGTGTCCTACAC
TTATTCTTTTCTTTTTTCCATTTTTTTGGGCTGAGAAAGCGAAGCACAAAAATTTGTCACTAGCTTCCTGCAGGTGACGATCGATCAAGATCGGGGTCAT
CGCTGAAGGGCCGGCAAACGGGCAATCATGCTAGTCCGACGAGCTTCTCGCTGAGCTCCCAAACCTTCCTGGCCTTGAGGTCCTCGAGGAGCTCGCGGGC
GAGGAGAAAGTGGCCGAGGTGGTTGACGCCGACGCTCATCTCGAAGCCGTCGGCGGTGAAGGAGGGCTCCTTGGCGGTTGGCTGGTAGACGGCGGCGTTG
CAGACGACGACGTCGATGGGCATGTCGAGCTGGCGCACGTTGTTGACGAACTGGCGGACGCTGTCGAGGGAGGCCAGGTCGAGGTGGACGATGGTGTAGC
TGCCCTTAGGC