Detailed information on CNT30130322


BLAST search results

BLAST vs Swiss-Prot:
sp|P20143|PSAH_HORVU, E-value = 3e-42

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30285918Lolium perenneTriticum aestivum25.4644.0494.2207forward
CNT30384456Lolium perenneTriticum turgidum25.7139.0794.26209forward
CNT30435366Lolium perenneAegilops tauschii18.5733.1996.03151forward
CNT30656375Lolium perenneTriticum dicoccoides35.1874.0989.86286forward
CNT30679988Lolium perenneTriticum urartu34.6938.7493.62282forward

Expression of CNT30130322

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MERAEEGRTASLRPEMELPERPFTATGWTATRDAIAASCTVLSSSEDDDAVAGRCTDVVR

>peptide 2 (35 aa)
MGSSEPPPRSRNLSSRPRLVKGAAKVLKNLLCRPL*

>peptide 3 (39 aa)
MSSRSKYTLFSPYLATTAAPRALHHGRRVQLADHTHVMQ*

Sequence

>CNT30130322
GGCACTGTAATTGTACCATGTATACACACGGTCACATCACATGCACTGGACGATTAAAATCATCACCTGTATAAACATAGTACAACAGCACAGTAATTGA
ACATCAAATGGTCCAGTGGTAGAGTACTATGCATCACGCACGCAGCTAGCATCGTTTCAATTACTGATACGCGGAGTACAGGAATCAAGTATCAACATTA
CACAAAGATAGAAGTGGGATCAAGATCCATGGTACAAAGAGGAGGCAAGGGAAAGGAGAGAGCTTGATTGGAGCTTAGATCTTGCCGCGTGGGCCGGGGA
CGGGGGGCAGCTGGGGCCCCTTCTTGATGGGGAGCAGCGAGCCGCCGCCGAGGAGCAGGAACTTGAGCAGCAGGCCGCGCTTGGTGAAGGGCGCGGCGAA
GGTGTTGAAGAACTTGCTCTGCAGGCCGTTGTAGGGCGACGGCGCGTCGGAGCCGTACAGGTCCCACTGCCCCGTCGTGTTGCCGATGTCGTCCAGGTCG
AAGTACACGCTCTTCTCGCCGTACTTGGCCACCACCGCCGCGCCCCGAGCCCTGCACCATGGACGCAGAGTTCAGTTAGCTGATCACACACACGTAATGC
AGTGATAGAAACTCGTGTCTCGTACCTGCGGATGGAGCGGGCGGAGGAGGGCCGGACGGCGAGCTTGCGGCCGGAGATGGAGCTGCCGGAGAGGCCCTTC
ACGGCGACCGGCTGGACGGCGACGAGGGACGCCATTGCTGCGAGCTGTACAGTCCTTTCTTCTTCTGAAGACGATGATGCTGTGGCGGGTAGGTGCACAG
ACGTAGTTCGGTG