Detailed information on CNT30121163


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30515294Citrus clementinaJuglans regia43.1515.7682.24107forward

Expression of CNT30121163

Peptides detected in this lncRNA

>peptide 1 (81 aa)
RLALAKSFKSLFKVQEILAPAESTPKAFETLCEDLSCRLLLRAGTTPTLVGCISVAAACNEAAILLPTTRGLLASIPLSSKK

Sequence

>CNT30121163
CAGGCTTGCTCTTGCCAAATCCTTCAAGTCATTATTCAAAGTGCAAGAGATCCTAGCACCAGCTGAGTCGACACCAAAAGCCTTCGAAACGCTCTGTGAA
GACCTCAGCTGCAGGCTGCTGCTGCGAGCGGGTACCACACCCACCTTGGTGGGTTGCATCAGTGTAGCTGCGGCTTGTAACGAGGCTGCCATCTTGCTCC
CTACCACTCGTGGGTTACTTGCTAGTATCCCTTTATCTTCTAAGAAAC