Detailed information on CNT30121049


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONSLYT000794, E-value = 4e-58

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30640872Citrus clementinaNymphaea colorata51.273.1881.23554forward
CNT30536082Citrus clementinaEucalyptus grandis54.5399.6682.37590forward
CNT30316118Citrus clementinaCorylus avellana54.5382.6380.68590forward
CNT30549166Citrus clementinaIpomoea triloba45.9373.9680.89497forward
CNT30516792Citrus clementinaJuglans regia81.6199.2182.22883forward
CNT30700805Citrus clementinaQuercus lobata2810085.81303forward
CNT30376158Citrus clementinaArabidopsis thaliana33.1840.1684.68359forward
CNT30269243Citrus clementinaChenopodium quinoa57.368.0680.48620forward
CNT3021339Citrus clementinaCitrullus lanatus57.397.7980.32620forward
CNT30727660Citrus clementinaCorchorus capsularis48.9896.8984.34530forward
CNT30378927Citrus clementinaManihot esculenta54.8195.884.32593forward
CNT30403468Citrus clementinaBeta vulgaris36.7851.4280.65398forward
CNT30524942Citrus clementinaPhaseolus vulgaris36.5158.8779.49395forward
CNT30489068Citrus clementinaOlea europaea34.8476.3282.49377forward
CNT30710559Citrus clementinaGlycine max32.0752.5883.86347forward
CNT3042435Citrus clementinaPrunus dulcis63.499.1382.51686forward
CNT3091337Citrus clementinaSolanum tuberosum38.4550.9881.01416forward
CNT30559890Citrus clementinaActinidia chinensis55.2787.5579.77598forward
CNT30591924Citrus clementinaMusa acuminata45.191.5679.1488forward
CNT30235097Citrus clementinaBrassica oleracea41.556.0579.73449forward
CNT30508904Citrus clementinaSolanum lycopersicum32.0756.1580.12347forward
CNT30554721Citrus clementinaOryza glaberrima37.1542.9980.1402forward
CNT30256659Citrus clementinaAvena sativa22.0933.4382.01239forward
CNT3076593Citrus clementinaBrassica juncea38.4576.1980.29416forward
CNT30263629Citrus clementinaBrassica rapa2852.8882.18303forward
CNT30468674Citrus clementinaSaccharum spontaneum29.334.5780.44317forward
CNT3016767Citrus clementinaZea mays37.1553.1781.09402forward
CNT30216752Citrus clementinaKalanchoe fedtschenkoi18.7643.8484.24203forward
CNT30648676Citrus clementinaRosa chinensis54.8179.681.45593forward
CNT30687113Citrus clementinaTriticum urartu27.6356.280.6299forward
CNT30350932Citrus clementinaEragrostis tef36.0487.2582.56390forward
CNT30366857Citrus clementinaSorghum bicolor37.1540.9479.6402forward
CNT30596736Citrus clementinaOryza meridionalis22.0931.6682.43239forward
CNT30370935Citrus clementinaOryza glumipatula27.9131.281.79302forward
CNT30154742Citrus clementinaPrunus persica67.7487.3782.95733forward
CNT30705859Citrus clementinaPrunus avium56.3881.6683.44610forward
CNT3027877Citrus clementinaTheobroma cacao34.0193.1685.05368forward
CNT3051605Citrus clementinaAmborella trichopoda61.1899.8578.85662forward
CNT3035176Citrus clementinaCucumis melo41.7782.1880.75452forward
CNT30330871Citrus clementinaDioscorea rotundata28.4742.683.77308forward
CNT30150463Citrus clementinaBrachypodium distachyon32.4439.9380.06351forward
CNT30103173Citrus clementinaOryza rufipogon25.9728.9482.56281forward
CNT30584443Citrus clementinaEchinochloa crusgalli20.1531.4683.94218forward
CNT30558075Citrus clementinaPanicum hallii27.0837.1483.28293forward
CNT30551544Citrus clementinaOryza brachyantha33.2751.882.22360forward
CNT3049385Citrus clementinaCucumis sativus48.9866.9281.32530forward

Expression of CNT30121049

Peptides detected in this lncRNA

>peptide 1 (28 aa)
MIRSPRHRRTSRCHAKLQTFHITRKLKFD

>peptide 2 (71 aa)
MLGCRKERLGCTMVKWGCMQVRWGYMPVRWGYSLVKLDCNWEKWGCNLERSGCSLGMLGCNLGRLGYSLVK*

>peptide 3 (81 aa)
SRYNNVKNNRDKIINNLIPSKSNPQLQQVLGSTDISVYRILSKTRPNKLDTAFNTNIRLDHISHYGLPVIWRCRAVRTGRR*

Sequence

>CNT30121049
ATCCAGATATAATAATGTTAAAAACAACAGAGATAAAATCATTAATAATTTAATCCCATCCAAGTCCAATCCCCAGCTACAGCAAGTCTTAGGTTCAACA
GATATTTCAGTATATAGAATTCTATCAAAAACAAGACCTAATAAATTGGATACAGCTTTTAACACAAACATTAGACTTGACCACATATCGCACTATGGCT
TACCTGTAATTTGGAGATGTAGGGCTGTACGGACTGGCAGGAGATAATCTTGGACTACTTGGTGAGTAGGCCAGCGACGGACTGTATTTGGCAGACTGAG
GATTGTAGCTTGGGGATGTAGGACTATAGGTTGGTGAAGTTGGGCTATAACTTGGTGAAGTTGGACTATAACCAGGAGAAGTGGGGCTATAGGCTGGTGA
AGTGGGGCTGTACGATGGAGAAGTGGGGCTGTATGACGGTGAGGTAGGGCTGTACGAAGGTGATGTTGGGCTGTAGGAAGGAGAGGTTGGGCTGTACGAT
GGTGAAGTGGGGCTGTATGCAGGTGAGGTGGGGCTATATGCCGGTGAGGTGGGGCTATAGCTTGGTGAAGTTGGACTGTAACTGGGAGAAGTGGGGCTGT
AACTTGGAGAGGTCGGGCTGTAGCTTGGGGATGTTGGGCTGTAACTTGGGGAGGTTGGGCTATAGCTTGGTGAAGTAGGTGAGTACGATGGACTGGTAGG
AGAATAGGCAGGACTGGTTGGACTATAACCAGGAGAACTTGGACTATAAGTTGGTGAGGTAGGGCTATATCCAGGCGAGGTGGGACTGTATCCAGGTGAA
GTTGGGCTGTATCCAGGTGACGTGGGACTGTATCCAGGAGATGACGGACTGTAGCCTGGTGATGATGGGCTGTATCCAGGTGATGAAGTAGGAGAGAAGG
CCATTCCACCAACATAAGGAGAAAACTGGGCATCCGTGACCGGGGACAGACGGAGATTTGGGCTAAACAAGTAACCTGGAGACATCATGCCATCATGATA
AGGAGTCCCAGACACCGGAGAACGAGCAGGTGTCATGCCAAACTCCAGACCTTCCATATAACTAGGAAGCTGAAGTTCGATG