Detailed information on CNT3012097


BLAST search results

BLAST vs Swiss-Prot:
sp|P29409|PGKH_SPIOL, E-value = 1e-54

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30176931Zea maysSecale cereale35.8246.6290.5221forward
CNT30370323Zea maysOryza glumipatula30.9642.5488.48191forward
CNT30604156Zea maysOryza punctata47.4952.0489.76293forward
CNT30557143Zea maysPanicum hallii47.8139.5492.2295forward

Expression of CNT3012097

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MFFISLVTLPRKDHSVNHILLGSSLFKRFPLAL*

>peptide 2 (37 aa)
MLHTVTVAASFNATTPGSSFPSNNSRLAPPPGQTCQQ*

>peptide 3 (42 aa)
MTTSVGSIRETPFSLAFASRDVASSSLSSSTNEAPTGRPCAL*

>peptide 4 (29 aa)
MKACFIRSQWRLHSTQQLPEAPFLPTIPG*

>peptide 5 (50 aa)
PRLPLNVFYITSYVTEERSLGKSHTIRVVVVQTISISSIKHWSLTFRASG*

Sequence

>CNT3012097
CCAAGATTGCCTTTGAATGTTTTTTATATCACTAGTTACGTTACCGAGGAAAGATCACTCGGTAAATCACATACTATTAGGGTCGTCGTTGTTCAAACGA
TTTCCATTAGCTCTATAAAACATTGGTCTCTTACATTTCGGGCGAGCGGCTGAGGAGGTGCAAGTGCAAGCGAGAATGTAGCAAGTATACAACGGCACGT
GAAGACGAAGACGAAACAAAATGAAAGCATGCTTCATACGGTCACAGTGGCGGCTTCATTCAACGCAACAACTCCCGGAAGCTCCTTTCCTTCCAACAAT
TCCAGGCTAGCGCCACCTCCCGGGCAAACTTGTCAGCAATGACAACATCGGTTGGCAGCATAAGGGAGACACCCTTTTCCTTAGCCTTTGCAAGTAGAGA
CGTTGCAAGCTCGAGTTTGTCTTCCTCGACCAATGAAGCACCAACAGGGAGACCTTGTGCCTTGTAAAACGTGAAGATCATACCACCACCCAAGAGAAGG
ATATCACACTTCTCCAACAGGGACTCAATAACCCCGATCTTGGATGACACCTTTGAACCACCCACGATGGCAGCAAAAGGGCGTTTAGGGCTTGAAACAG
CTCCGACAAGGTAGTCG