Detailed information on CNT30120735


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30528537Citrus clementinaEucalyptus grandis16.9785.9280.23177forward
CNT3093081Citrus clementinaSolanum tuberosum6.5222.8285.2968forward
CNT30127442Citrus clementinaCorymbia citriodora18.9870.9782.32198forward
CNT30570239Citrus clementinaVitis vinifera15.7279.6182.93164forward

Expression of CNT30120735

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MQLFTKHFLIAFKLSKLPYQTDPKLIYYIFYTT

>peptide 2 (48 aa)
MDNQKKVRPTTIIFTYKTKDGNKPIIYLPRVQDPASCSWKQRRVTQTD*

>peptide 3 (69 aa)
MATSQLFIYQESKILQAAAGNREGLHKLIEVLINCSVLDIRIKLRGFNSKRWFNLEVRLNSLHESRVIN*

Sequence

>CNT30120735
CCAACCCACGCACCCACCTGATCATGATGGCTTTATAACTACTACTCTCAAATCAAGTACATGGCCTACTTCATTTGATCACTGACATAGCAAACATAAT
ATGGTCTAACAAATTCCATGGACAACCAGAAGAAAGTAAGGCCAACAACCATAATTTTTACATATAAAACCAAAGATGGCAACAAGCCAATTATTTATTT
ACCAAGAGTCCAAGATCCTGCAAGCTGCAGCTGGAAACAGAGAAGGGTTACACAAACTGATTGAGGTACTCATCAACTGTAGTGTACTTGACATCAGGAT
AAAGCTGCGAGGCTTCAACTCCAAACGATGGTTCAATCTTGAAGTCCGTTTGAACTCCCTCCACGAAAGCAGAGTGATAAATTGATAACAACCTCCCGAG
TGGAGGTGCAGCTTCTGCAACATTTTGGAGAAGACAGGATCAATAAGGCAAAAATTCGCGGCTTTCTTTAATAACATTTAGAAGTGAGAGTTTTAACTAG
CCTTGAATATTCTTTAGGAGCTGCTCTTCTGAAACATACTCCCTTTCGAGGGTTTTGCCAATCTTTCTCTCCCACAGAGACACAAGATCATTGAACGAAT
AAATATTGCCGGGAGGCTGAATGTAAAGGATTTTGTTCAAGGTTCTGGGATCATCAACCGCTTTGATAGTATAGGTTCCAATATCATCTTCCTTGTTATA
AACAGCTGAAAATCAAATGACGAAACCAGTTAGCTTAGATTCATTAAACTATTTTGTTACAGTTGTGATGTAGCAGTTAAGCAGTTAAAGTGTTTAGTAA
TTACTTTATCTTACAGTTATTTGGATTTATTTAGTATTGAGGTGCTCACAAAAAAAAAAAAAAAGAAGACAGTATTTTTGACAAAATTAGTCAAGGATTA
TAAGTTTTAATCAAACAACTATTAGATAAAATCATCTTAGTTTAATGCAATTATTTACCAAACACTTTTTAATTGCTTTTAAGCTTTCCAAACTACCATA
CCAAACAGACCCTAAATTAATTTACTATATCTTCTATACTACA