Detailed information on CNT30120699


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30530842Citrus clementinaEucalyptus grandis60.6696.0897.39882forward
CNT30730458Citrus clementinaCorchorus capsularis61.4967.0796.31894forward

Expression of CNT30120699

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MITRRIARPPCRRRIIQISALSTFDGRIEAYHGGDG*

>peptide 2 (45 aa)
CVLLFASDGAGLALLGASVDPTAIASGMRDARQGHSQVNGRACEW*

>peptide 3 (77 aa)
MLRMDVRSRPRSSKLHASSLDANDRRTRLGRPTEAPNGAPRGTDMRAPASGRNATWLILPVVICLSQRLSHACVSMN*

>peptide 4 (44 aa)
MHLLDKRSTRALPVALMIHDNSTDRKATVPATHHSNFCPINFRW*

>peptide 5 (34 aa)
CAAFRVRRCWLSLAWCFRRPDGNCFGHAGRSARS*

Sequence

>CNT30120699
TGTGTGCTGCTTTTCGCGTCCGACGGTGCTGGCTTAGCCTTGCTTGGTGCTTCCGTAGACCCGACGGCAATTGCTTCGGGCATGCGGGACGCTCGGCAAG
GTCATAGCCAAGTGAACGGCAGGGCGTGTGAGTGGTGATTGGAGGGCGTCAGTCTGCAGGCTCCGTGCTCGTGCACCGAACTGCTCGAAGGCCGTCCGCT
TCAGTCTTTCCCCAAGCGCAGCTGTTGCCTTGAGGGTTTGTTCGGTATCCTGTGTTGCTTACCAACAAAACGGAATTGCTGGTTTCGATTTTCCCCGTCC
GCCTTGTGCCCTTCCGGGTGCGGGGTGGACGCGAGGCGAGCTCCGTGTTCCCGCCGTGCCTCGCGCTCAGACGCTTGGCCGCCTCGGCCCACGAAGTCTC
TGCCCGTTCTCTCGGATGCGGAATGCTGCGCATGGACGTGAGGTCTCGGCCTCGATCGTCCAAGCTACACGCATCGTCTCTTGACGCGAACGACCGCCGC
ACCCGTCTTGGCCGACCGACCGAGGCCCCGAACGGGGCCCCGAGAGGGACGGACATGCGGGCGCCGGCGTCGGGAAGGAATGCTACCTGGTTGATCCTGC
CAGTAGTCATATGCTTGTCTCAAAGATTAAGCCATGCATGTGTAAGTATGAACTAATTCAGACTGTGAAACTGCGAATGGCTCATTAAATCAGTTATAGT
TTGTTTGATGGTATTTGCTACTCGGATAACCGTAGTAATTCTAGAGCTAATACGTGCACCAAACCCCGACTTCTGGAAGGGATGCATTTATTAGATAAAA
GGTCGACGCGGGCTCTGCCCGTTGCTCTGATGATTCATGATAACTCGACGGATCGCAAGGCCACCGTGCCGGCGACGCATCATTCAAATTTCTGCCCTAT
CAACTTTCGATGGTAGGATAGAGGCCTACCATGGTGGTGACGGGTGACGGAGAATTAGGGTTCGATTCCGGAGAGGGAGCCTGAGAAACGGCTACCACAT
CCAAGGAAGGCAGCAGGCGCGCAAATTACCCAATCCTGACACGGGGAGGTAGTGACAATAAATAACAATACCGGGCTCTATGAGTCTGGTAATTGGAATG
AGTACAATCTAAATCCCTTAACGAGGATCCATTGGAGGGCAAGTCTGGTGCCAGCAGCCGCGGTAATTCCAGCTCCAATAGCGTATATTTAAGTTGTTGC
ATTAAAAAGCTCGTAGTTGGACCTTGGGTTGGGTCGGCCGGTCCGCCTCGCGGTGTGCACCGGCCGGCTCGTCCCTTCTGCCGGCGATGCGCTCCTGGCC
TTAACTGGCCGGGTCGTGCCACCGGCGCTGTTACTTTGAAGAAATTAGAGTGCTCAAAGCAAGCCTACGCTCTGTATACATTAGCATGGGATAACATCAT
AGGATTTCGGTCCTATTCTGTTGGCCTTCGGGATCGGAGTAATGATTAACAGGG