Detailed information on CNT30120612


BLAST search results

BLAST vs Swiss-Prot:
sp|P48631|FD6E2_SOYBN, E-value = 5e-64

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30508441Citrus clementinaSolanum lycopersicum22.710.8382.52143forward
CNT30649933Citrus clementinaRosa chinensis22.8665.7584.03144forward

Expression of CNT30120612

Peptides detected in this lncRNA

>peptide 1 (32 aa)
HSLYQQLPGLLGTSPILKNGNVAVKGECAATM*

>peptide 2 (43 aa)
MVALSMELASRDQNPPSWALKVQPFVHLHPLFLNLATVYKYTIN

>peptide 3 (39 aa)
MASKSIIRPTGYIECQVQRPDKREGEEVGECKCRQCSKR*

Sequence

>CNT30120612
CATAGTCTCTATCAACAGTTGCCAGGGCTCCTCGGAACCAGTCCCATTCTGAAGAATGGTAATGTGGCAGTGAAGGGTGAGTGTGCTGCAACAATGTGAT
CAAAACGAGAAATCCGTTCACTACCAGCAAAGGTCCTCCATAGATGCAGAACACGTACACAAGTCCTTTTGCTGCTACAAGACAGTAGAGACTGTAAATC
ATAGCTAAAATTCCAGCATCAGAAATGAAAATTTGGAGCCTCTCGCGGTGTGAGTAGATGGGGCCATAAGGATCAAAATGGCAAGCAAATCTATCATAAG
GCCTACCGGATACATTGAATGCCAGGTACAAAGGCCAGATAAGAGAGAGGGTGAGGAAGTTGGTGAATGTAAGTGTCGGCAATGTAGTAAAAGATAAAGG
CAATGGTGAGGTCATGAACAACGTAGGAGAATGAACGGAGAACAGACCGCTCAAAACAGTGAGGTGGGATAGCTTTCTTTACTTGGCTGAGTGTGAATGG
TGGCTTTGAGCATGGAACTCGCTTCAAGGGATCAGAATCCACCTTCATGGGCGTTGAAGGTACAGCCATTCGTCCACCTGCACCCATTGTTCCTCAACCT
GGCCACAGTATACAAGTATACAATCAACTT