Detailed information on CNT30120609


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 9e-155

BLAST vs NONCODE:
NONGMAT000502, E-value = 2e-114

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30500332Citrus clementinaCoffea canephora78.7184.6884.19658forward
CNT30157672Citrus clementinaPistacia vera82.8966.7686.58693forward

Expression of CNT30120609

Peptides detected in this lncRNA

>peptide 1 (60 aa)
MKRRFLLDIVIGQGAAVFELFSGEDQTLLVRRDSFLVLDLGLDVVDGVGALDFESNGLAG*

>peptide 2 (31 aa)
MVSELSTSRVIVFPVNVLTKICMPPLRRKTR*

>peptide 3 (95 aa)
RSESPSETTTSETEDEMEGGLLLNVVISQSTPVLKLLPSEDEPLLIRWDPFLVLNLGFDIVNGIRTLYLQGNRLPGQCLNKNLHATPQTQNQMKS*

Sequence

>CNT30120609
GCGCAGTGAATCCCCCTCAGAAACCACCACCTCGGAGACGGAGGACGAGATGGAGGGTGGACTCCTTCTGAATGTTGTAATCAGCCAGAGTACGCCCGTC
CTCAAGCTGCTTCCCAGCGAAGATGAGCCTCTGCTGATCAGGTGGGATCCCTTCCTTGTCCTGAATCTTGGCTTTGACATTGTCAATGGTATCAGAACTC
TCTACCTCCAGGGTAATCGTCTTCCCGGTCAATGTCTTAACAAAAATCTGCATGCCACCCCTCAGACGCAAAACCAGATGAAGAGTTGATTCCTTCTGAA
TGTTGTAATCCGCGAGCGTCCTTCCATCCTCCAGCTGCTTGCCAGCGAAGATCAAACGCTGCTGGTCCGGCGGAATCCCTTCCTTGTCCTGGATCTTGGC
CTTGACGTTGTCGATCGTGTCGGAGCTCTCGACTTCGAGGGTAATCGTCTTTCCCGTTAGGGTTTTGACGAATATCTGCATGCCCCCACGGAGACGAAGC
ACGAGATGAAGCGTCGATTCCTTTTGGATATTGTAATCGGCCAAGGTGCGGCCGTCTTCGAGCTGTTTTCCGGCGAAGATCAGACGCTGCTGGTCCGGAG
GGATTCCTTCCTTGTCTTGGATCTTGGCCTTGACGTTGTCGATGGTGTCGGAGCTCTCGACTTCGAGAGTAATGGTCTTGCCGGTTAGGGTTTTCACGAA
GATCTGCATCTTTTAAAAGTTTCTTAGCGAGAGAATTGGAGAGATTTGTTGAGAATATCGAATAACCCGATTGGGTGAAACAGGTGAGAGAGGAGCGCTT
TAAATAGAAGAGGAAGCCGACTCAATTAAGGAAAAG