Detailed information on CNT30120214


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30533222Citrus clementinaEucalyptus grandis15.9825.2396.3482forward
CNT30317675Citrus clementinaCorylus avellana15.429.3794.9479forward
CNT30549577Citrus clementinaIpomoea triloba15.221.7998.7278reverse complement
CNT30514313Citrus clementinaJuglans regia16.1822.1996.3983forward
CNT30701352Citrus clementinaQuercus lobata16.1820.9696.3983forward
CNT30376000Citrus clementinaArabidopsis thaliana16.3722.4694.0584forward
CNT3071712Citrus clementinaQuercus suber16.1820.9196.3983forward
CNT30506884Citrus clementinaNicotiana attenuata14.8130.5297.3776forward
CNT30542653Citrus clementinaBrassica napus15.5920.469580forward
CNT30236394Citrus clementinaBrassica oleracea15.5921.629580forward
CNT30309894Citrus clementinaCamelina sativa15.237.3293.5978forward
CNT3075181Citrus clementinaBrassica juncea15.5921.929580forward
CNT30261820Citrus clementinaBrassica rapa15.5925.569580forward
CNT30219096Citrus clementinaKalanchoe fedtschenkoi15.222.2293.5978forward
CNT30126894Citrus clementinaCorymbia citriodora15.5922.1696.2580forward
CNT30620847Citrus clementinaCajanus cajan16.3723.4696.4384forward
CNT30429165Citrus clementinaPapaver somniferum15.9823.195.1282forward
CNT30572709Citrus clementinaVitis vinifera16.1828.0498.883forward
CNT30704991Citrus clementinaPrunus avium16.3727.1897.6284forward
CNT3024248Citrus clementinaPopulus trichocarpa15.9825.7196.3482forward
CNT30175528Citrus clementinaVigna angularis15.7925.9696.381forward
CNT30725207Citrus clementinaLupinus angustifolius15.421.9497.4779forward
CNT30115210Citrus clementinaEutrema salsugineum15.231.7194.8778forward

Expression of CNT30120214

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MGLCFAYSESYCILYLLFSFYFLLSLFSCTHRFNQVVKLYPSLKLINR

Sequence

>CNT30120214
CATCAACCATTATCAAACATTCTCTAGGGTTTTATTTACCCTATAAATACACAGCAAAGCCCTGAGCTAACAGTCCTTTTCTCTCGTTACCGCAGCCTCA
GTAAAGCGATTAGGGTTTGAATTGAAGAAGCCAGTTTCGGAAACTTCTCACCATGAGAGCTAAGTGGAAGAAGAAGCGTATGAGGAGGTTGAAGAGGAAG
CGCCGAAAGATGAGACAGAGATCCAAGTAGTCTTATTCCTTAGTGCGGCGTCGTTTTTTAGCTATTTTGTTGCTTTGTTGTTTTGCCTATCAATTAGTGA
TTTTGATGTTTTAATTTCATGTTTTAATACATTTTGTTGATTCCAGTGAATCACTTTATTAGCTCTAAATGGGATTATGTTTTGCTTATTCAGAATCATA
TTGCATTCTATATCTTTTGTTTTCATTTTATTTTCTTCTGTCACTTTTTAGCTGTACTCATCGATTTAATCAAGTGGTTAAGCTATATCCATCTCTTAAG
CTTATAAATAGGC