Detailed information on CNT30119815


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9ASR1|EF2_ARATH, E-value = 3e-73

BLAST vs NONCODE:
NONSLYT002586, E-value = 1e-86

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693909Citrus clementinaOryza sativa26.588.6286.07122forward
CNT30674978Citrus clementinaSetaria viridis27.6717.0782.68127forward
CNT30640184Citrus clementinaNymphaea colorata38.7823.5183.15178forward
CNT30547471Citrus clementinaIpomoea triloba59.4850.4686.08273forward
CNT30512774Citrus clementinaJuglans regia80.6129.6588.38370forward
CNT30372970Citrus clementinaArabidopsis thaliana47.4944.2282.11218forward
CNT3019595Citrus clementinaCitrullus lanatus40.7433.6985.03187forward
CNT3071371Citrus clementinaQuercus suber29.8547.7486.13137forward
CNT30405832Citrus clementinaBeta vulgaris63.1836.1685.17290forward
CNT30636551Citrus clementinaCapsicum annuum6142.4287.5280forward
CNT30192963Citrus clementinaSecale cereale20.717.7990.5395forward
CNT30224842Citrus clementinaHordeum vulgare72.9876.4883.88335forward
CNT3085191Citrus clementinaVigna radiata35.7322.8785.37164forward
CNT30510528Citrus clementinaSolanum lycopersicum80.6128.7385.95370forward
CNT30143750Citrus clementinaMedicago truncatula103.4962.0182.11475forward
CNT30441049Citrus clementinaAegilops tauschii72.9888.6284.18335forward
CNT30665536Citrus clementinaTriticum dicoccoides55.7738.8582.42256forward
CNT30309889Citrus clementinaCamelina sativa67.7631.6781.35311forward
CNT30263748Citrus clementinaBrassica rapa67.5442.6483.55310forward
CNT30612508Citrus clementinaArabis alpina69.0612.4983.28317forward
CNT30445994Citrus clementinaSaccharum spontaneum82.3526.5481.75378forward
CNT301916Citrus clementinaZea mays21.7924.5791100forward
CNT30716253Citrus clementinaMalus domestica golden79.9627.6884.47367forward
CNT30361828Citrus clementinaSorghum bicolor7869.1182.12358forward
CNT30706279Citrus clementinaPrunus avium82.3562.2786.24378forward
CNT3054398Citrus clementinaAmborella trichopoda62.5341.8482.58287forward
CNT3024028Citrus clementinaPopulus trichocarpa45.3228.1585.1208forward
CNT30557952Citrus clementinaPanicum hallii21.7912.2790100forward

Expression of CNT30119815

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MTRFINALPIKSFSSDFIVTPSFCNMGHSLSF*

>peptide 2 (60 aa)
GINFLLISQGSIFSDELIETNHSHSVTTSSQHDIFGPWKEREGERSSFPKVHYLQEARSA*

Sequence

>CNT30119815
GGCATCAACTTCCTTCTCATTAGTCAAGGTAGCATTTTTAGTGATGAATTGATCGAGACCAACCATAGCCACAGTGTTACCACAAGTTCTCAACACGATA
TTTTTGGGCCGTGGAAGGAGAGGGAAGGTGAAAGATCATCATTTCCAAAAGTGCACTACTTGCAGGAAGCCAGGTCTGCATGACACGCTTCATCAATGCC
TTGCCCATCAAATCCTTCTCTTCTGACTTCATCGTGACACCAAGCTTTTGCAACATGGGCCACAGCTTATCTTTCTGATCATTCATGCAAGTGTTGATAA
TCTGCTTAATCGGTTCATAGCAAAACTGAACAAAACCACGCTTGCATGTCGCACTACCAGTGTTCTTGGTTGTCCACTTCTTTGTGGCCGGGTCAAAGAA
ATTCTCACCCCAGAGCCTCTCCATCATCTTAGACTCATCGACTCCAAATTTTGATGCAT