Detailed information on CNT30119447


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9XJ57|CHS2_CITSI, E-value = 7e-74

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30379505Citrus clementinaManihot esculenta24.4832.8780.95189forward
CNT30712527Citrus clementinaGlycine max19.6932.5580.26152forward
CNT30150913Citrus clementinaBrachypodium distachyon11.6623.286.6790forward

Expression of CNT30119447

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MESETDFAQVSVNCTVRVREDRLRSRHELIQRTLDRRVRIGTHDHSSSTITEQSLAHKRIKM

>peptide 2 (30 aa)
HIKIMTFGHLQILDIQLQIYYFLKFPRIYA*

>peptide 3 (41 aa)
MEFSLQALMGTLCSTTVSTVSPGPNPNSTPQSSPSPVDTSA*

>peptide 4 (54 aa)
MPSGANASDRLFSIFFEIKPGTSLSKWKVRPTSRKCPSIAPSESGRIVCEVDTS*

Sequence

>CNT30119447
CCCACATTAAAATCATGACCTTTGGGCATTTACAGATTCTGGACATCCAGTTACAAATTTACTACTTTCTCAAATTCCCAAGAATTTATGCATAAACACA
AAGCGTTGCCCAGGTTTGGTGACGTCATAAGAGAAAAGGCACGATGCCTTAAACTCAATTGACAAAACTAAACCTTCACACGATCAACCAATAATTCAAC
TGTGAAAGCATACAACATAAAGTTACTGAACTACTAAACATACTGATGGAGTTCTCACTTCAAGCTTTGATGGGGACACTGTGCAGCACAACGGTCTCGA
CGGTGAGCCCCGGCCCGAACCCGAACAGCACACCCCAATCAAGCCCTTCGCCGGTGGACACAAGCGCTTGACATGTTACCGTACTCACTCAACACTTGAC
GTGTGGCCTTCAGCTTCTCCCCTTTGAGGCCCAGTTTAGACTCCACTTGGTCCAGAATTGCGGGCCCACCGGGGTGAGCGATCCAGAATATCGAGTTCCA
GTCGCTGATGCCAAGCGGGGCGAACGCTTCAGACAGGCTTTTCTCTATATTCTTTGAGATCAAGCCGGGGACGTCTTTAAGCAAATGGAAAGTGAGACCG
ACTTCGCGCAAGTGTCCGTCAATTGCACCGTCAGAGTCAGGGAGGATCGTCTGCGAAGTCGACACGAGCTGATACAACGGACGCTCGACCGACGTGTCAG
GATCGGCACCCACGATCACAGCAGCAGCACCATCACCGAACAAAGCCTGGCCCACAAGAGAATCAAGATGAG