Detailed information on CNT30119031


BLAST search results

BLAST vs Swiss-Prot:
sp|O24339|CATA_SOLAP, E-value = 3e-55

BLAST vs NONCODE:
NONBNAT004861, E-value = 7e-19

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30317874Citrus clementinaCorylus avellana29.6492.2189.33225forward
CNT30373064Citrus clementinaArabidopsis thaliana28.0637.380.75213forward
CNT30708847Citrus clementinaGlycine max22.791887.86173forward
CNT30398713Citrus clementinaTriticum turgidum35.5799.2681.85270forward
CNT30567579Citrus clementinaActinidia chinensis20.0344.3185.53152forward
CNT3085325Citrus clementinaVigna radiata27.829.8483.41211forward
CNT30511681Citrus clementinaSolanum lycopersicum20.8247.5981.65158forward
CNT30668910Citrus clementinaTriticum dicoccoides35.9797.1582.05273forward
CNT30611006Citrus clementinaArabis alpina16.0740.1383.61122forward
CNT308572Citrus clementinaZea mays26.8870.3483.82204forward
CNT30715065Citrus clementinaMalus domestica golden35.719.0688.93271forward
CNT30624536Citrus clementinaDaucus carota26.3514.2386200forward
CNT30368346Citrus clementinaSorghum bicolor26.8875.5683.82204forward
CNT30359648Citrus clementinaLactuca sativa35.0568.2181.58266forward
CNT3051600Citrus clementinaAmborella trichopoda18.9737.479.86144forward

Expression of CNT30119031

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MDNSGEADNDRRLNPWGSKEISTSKVRNIMGALKETLSTGSPSMDDTFWNPLPGKMS*

>peptide 2 (59 aa)
MKICYSNHITWENLPKQLKNSYFPYFTITIIKFLKHHNQNRKISCSFSKSNLKLQVPMP*

Sequence

>CNT30119031
GCGTAAGAACCTATCAACAAGTAGGGGAGCTAACTTCTTGACAGCCTGCAACTTGTCCACCTTCATGGAGTAATAAAATATCGGATGACTTAAAACACAC
GAAATGCTGAACCTATGCAGCCTTCATGACTAAGTGATTACATATTTACATACGATTGAAGACACATGAAAATATGTTATAGCAACCACATCACATGGGA
AAATCTGCCGAAGCAATTGAAGAACTCTTATTTTCCCTATTTCACCATTACAATTATAAAATTTTTGAAGCATCATAATCAAAATAGAAAAATCTCCTGT
TCTTTCAGCAAAAGCAACTTAAAGCTACAAGTACCCATGCCCTAAATACATGCATCATTTGTAACTAAACGATCATCTCCATGATCCCCCACATATTACA
TACCATCTAATACACATTAGTAATAAAACAAGTATGACATAAGCCCCTCTCACCTCTCTGGTGTAAAACTTGACCGCAAATCCTCGAGGATCTCTCAGGG
TTTCAGGGCTGCCACGCTCATGGATAACAGTGGAGAAGCGGACAATGACAGGCGTCTGAACCCCTGGGGCTCGAAGGAAATCAGCACAAGTAAGGTGAGA
AATATCATGGGTGCACTCAAAGAAACCCTTAGCACTGGCTCCCCTAGCATGGACGACACGTTCTGGAATCCTCTCCCTGGCAAAATGAGCTAGTTTCTCC
ACCAGATGATAATCCTCAAGAAGGACAGGACCTGTTAGTGAGTGATCCAAAACACCATG