Detailed information on CNT30118069


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30118069

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MPAPYFTPSRKTESSFSSDREFSMVITSASMLMMEWMMSLKLE*

>peptide 2 (52 aa)
MGMSDLGPKRLTKPNHRQWIHWTQIIQKQDGYDGIPPRNLRELAAKAILTSR*

Sequence

>CNT30118069
CAACTCGGGTGAAAACCAGACAAAAGCCTTGGGTACTTGGCAGAACATAACATCAACTCTCCTTGAAAATTTTGTAATTTGATCCGCAACAACTCAGATG
TAGATGAAACACTGCTGATTTCCACTCAGTTTACAATACAAATACACCGACAGACTGCCTCAAAAACCACCAAATTCATTCAAAGTAAAATGGGTATGAG
TGATCTTGGCCCCAAGAGACTGACTAAACCTAACCACAGACAGTGGATCCACTGGACCCAGATTATTCAAAAACAAGATGGCTATGATGGCATTCCTCCT
CGCAATCTAAGGGAACTTGCTGCAAAGGCGATCCTCACTTCGCGCTAGCGAGCTGGGTGCGGATGAGCTTGGGTTCACCCAGAGAATGTTAGTGTCGAGC
ACCGCAAGCATCTTGTTGATGCGGTCCGCAATCTCCTCCGTGGACGGGATCCTGGGGGAGTGGATGTCATAGACACCAGGACCAATGCCAGCACCATACT
TCACACCCTCGCGGAAGACAGAGAGCAGCTTCTCGTCGGACCGGGAGTTCTCGATGTGGATGTCATAGACACCAGGGCCAATGCCAGCACCATACTTCAC
ACCCTCACGGAAGACAGAGAGCAGCTTCTCATCGGACCGGGAGTTCTCGATGGTGATCACATCAGCGTCCATGTTGATGATGGAGTGGATGATGTCGTTG
AAGTTAGAGTAGC