Detailed information on CNT30118059


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672574Oryza nivaraSetaria viridis25.9413.2492.1176forward
CNT30377828Oryza nivaraArabidopsis thaliana21.518.2685.7163forward
CNT30224666Oryza nivaraHordeum vulgare34.1345.0588100forward
CNT30555741Oryza nivaraOryza glaberrima60.7580.5497.19178forward
CNT30264951Oryza nivaraBrassica rapa21.518.7588.8963forward
CNT30282Oryza nivaraZea mays31.430.2690.2292forward
CNT30478263Oryza nivaraArabidopsis halleri21.518.2185.7163forward
CNT30367300Oryza nivaraSorghum bicolor29.0118.8587.0685forward
CNT30619828Oryza nivaraCajanus cajan27.322.18580forward
CNT30597166Oryza nivaraOryza meridionalis60.0762.4198.86176forward
CNT30105511Oryza nivaraOryza longistaminata60.7571.296.07178forward
CNT30104764Oryza nivaraOryza rufipogon92.83101.8795.22272forward
CNT30578474Oryza nivaraOryza barthii61.0989.598.88179forward
CNT30604899Oryza nivaraOryza punctata60.7576.3997.75178forward
CNT30333329Oryza nivaraCynara cardunculus28.3317.1585.5483forward

Expression of CNT30118059

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MLRPSTTPAKRYFPEGKPALLIRSRVLAPRIRSKP*

>peptide 2 (36 aa)
LYDSAGMSAKYVSISTFNPESADSSSVYAAENAANW*

Sequence

>CNT30118059
CTTGTATGATTCAGCAGGAATGTCAGCGAAGTATGTCTCAATAAGCACATTCAATCCAGAAAGTGCCGACTCAAGTTCTGTGTATGCAGCAGAGAATGCA
GCCAATTGGTGAGAGTCAAGAGACTCAAGGGTAGTGAGAGATGCAGCGAGATCATCAGCCCAGATGTTGCGTCCATCCACAACACCGGCAAAGAGGTACT
TTCCAGAGGGGAAACCAGCACTCTTGATAAGGTCAAGAGTCTTGGCTCCACGGATAAGGTCAAAACCATAAGCAGTCACGCTGTTCAGGGATG