Detailed information on CNT30118018


BLAST search results

BLAST vs Swiss-Prot:
sp|O49290|CPPM_ARATH, E-value = 1e-27

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555734Oryza nivaraOryza glaberrima28.6369.8599.68621forward
CNT30371470Oryza nivaraOryza glumipatula19.5573.3699.53424forward
CNT30604894Oryza nivaraOryza punctata30.4327.1789.39660forward

Expression of CNT30118018

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MNLLKIYSLVVKIDRSNLNESLTLKRFSRT*

>peptide 2 (44 aa)
MSSQESRPTRLLNSAKVVRRWSSSRVVSARLRAARTSTRARAAA*

>peptide 3 (41 aa)
MASSRPVTDRASVRATIKKSRSPTTSLAAAIFTACSSAGIT*

>peptide 4 (55 aa)
RNHAPNPNIITHTAIYSYVPCNNNTYLTKFTNNAGELINVIHQISWLPDGQPHFD*

>peptide 5 (47 aa)
MLDRSDLARTCHLIHQRHIYTYKSKVVMGPPYLTVHAWYKMLGPTCH*

>peptide 6 (66 aa)
MIYLSLEKRSGRSAYIYVEIGTPNGIIKTSDRSSVSPGHDKEVPITNDLSRCSYLHSVLLCWYHLI*

Sequence

>CNT30118018
TGCGGAATCACGCACCCAATCCCAACATAATCACTCACACAGCAATATATAGCTACGTACCATGCAATAATAACACATACCTCACAAAATTCACCAATAA
TGCAGGAGAATTAATCAATGTAATCCACCAAATTTCATGGCTCCCTGATGGCCAGCCACATTTCGATTGATAATTTATTCCATTGGTAGCTTGATCTTGA
TCGATCTTAGTGTACCCCATTGGTAGCGCCATTGGTAGCTCCGTTTCCGGCGACGACGGCGGCCGCCTTGGCCTTAGCCTTCTCCATCTCCGTCGTGGTC
GTCGTCTCCGGCGCCGGCAGTGGCTTGGGAACGGAGGAGTTGACGGAGAAGCGGGCCTCGATGTCGAGCCAGGAGTCGAGGCCGACGAGGTTGTTGAACT
CGGCGAAGGTGGTGAGGCGGTGGAGCTCGTCGCGGGTGGTCTCGGCGCGCTTGAGGGCGGCGAGGACGTCGACGAGGGCGCGGGCGGCGGCGTAGACGGT
GGTGAGGGGGGACTTGATGAGCTCCTGCCTCGTGTGCAGCGGCGTCTTCCCGCCCTCCAGCATGTTGCACACGCGATAACCCTTGGTCCTCCTGCAGATC
TCCATCAGCTCCTCGTCGCTCCGCGGCGCCTCCACGAAGCACGCGTCTGCTCCCGCCTACAATTTTTTTTACATATATTCATATTAGATATGATATGATG
TTGCATAATAACTTAATTATATTTATGGTGATCTCTACTGGTATGAATATATCCTACTAGTAATAAGTAGGAAAAGAAATTATTCTATTATCCTTAGTTG
AGGTAGTAATATAATAGATATGATTTATTTGATTAGAAGAAAATGAACGGTTTATTAGATTGAATTCTACAACCGGTAAAGACCAATGTAAAAACACCAA
TGGGTTAAATTCCATTATAAAGGAGAAAAAAATATACTATACGGATATTGTTTGTGGGCCTAGTAATAGAAGACAAATAAAGATGCAAACCATTTTCATT
TCATTATGTAAAGAAAGTGTTTTCGCCTTACATATATCAGTTTTCAAAATGCAGCTTTGACCAATATCTAATGAAAAAACTAATTAATTTCAAAACATTG
ATTCTTGACAGACTTGATGAACTTGCTTAAGATTTATAGTTTGGTGGTTAAGATCGATCGATCAAATTTAAACGAGAGTTTGACTCTGAAGAGATTCTCT
AGAACATGATTTATCTCTCTCTAGAAAAAAGAAGTGGTCGATCAGCTTACATCTATGTAGAGATTGGCACGCCTAATGGCATCATCAAGACCAGTGACAG
ATCGAGCGTCAGTCCGGGCCACGATAAAGAAGTCCCGATCACCAACGACCTCTCTCGCTGCAGCTATCTTCACAGCGTGCTCCTCTGCTGGTATCACCTA
ATTTAATTTTAACCAACACAAGGAGAGAGAGAGAGAGATCAAGGTAATTAATGCCGGCCACAATTTTGTAATCCTTTGATGATGGTGACAAGATGCAGAA
CATGGTGCACTCGATCTTATTACCACTCTAGCTAAGCTAGAGAGAACATATAATGGCTGTGATAATATCATTAATTGATAAAAATGTTGGATCGATCGGA
TCTAGCTAGAACTTGCCATTTAATACATCAGAGACATATTTATACATACAAAAGCAAAGTTGTAATGGGTCCTCCATATTTAACAGTGCATGCATGGTAT
AAAATGTTGGGGCCTACGTGTCACTGAATTAATTCAGCAGAATCTTCATTTCCAATATCAATATGTTTAGTGAAAGTGAGACCATATATTCAAAGTAGAT
ATAAATATATATCAAATCTCCGCTGTGTGAAATAATAGAGGGTAAATATATATAGCTAGGGCGAATTTTCTGGTCATTTTGAACCATCCTAGCTAGCTAT
TTTTGCATTATAACTTGTGATAATTAAGTTGTGATTCATCACATTAGTCCTGTTATTATTTCGATGTCAGGGAACGACAGGATCGGTTACCAATTTATTT
CCTCATTAGATTTTGGCAGGTGTGCATTAAGTGTACGTACTTAAGCTATAAATTGGCATGGATTTGCAATGGTGAACAGAGTGCTAAACAGAATTAGTAT
CACTATACAGTAGTAGTACATGTTTGTCTAGAACATGAAGGGACAAAAACAGTGTCTTGTCAGTATTTA