Detailed information on CNT30118016


BLAST search results

BLAST vs Swiss-Prot:
sp|P18566|RBS2_ORYSJ, E-value = 3e-91

BLAST vs NONCODE:
NONCQUT000389, E-value = 1e-23

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30597219Oryza nivaraOryza meridionalis10072.2699.6758forward
CNT30104481Oryza nivaraOryza rufipogon60.5556.9599.13459forward
CNT30604884Oryza nivaraOryza punctata66.0973.4693.01501forward

Expression of CNT30118016

Peptides detected in this lncRNA

>peptide 1 (65 aa)
PDSSQPGGLYAMKLINCTCLTLSKPMMRTKASGYAFFASSSSLSTWVASVHPNMGSFHMVQYLPS*

>peptide 2 (50 aa)
MHLILPPLLTLPKLELLERRFTGRPAVDLSPWKGATEVAEEAITVGAIAT*

>peptide 3 (28 aa)
MSSSSAVEALYAGSPAAYINSNRIMSFHP

Sequence

>CNT30118016
CGCCTGACTCCTCGCAACCCGGTGGCTTATACGCGATGAAGCTGATTAACTGCACCTGCCTAACGTTGTCAAAGCCAATGATGCGAACGAAGGCATCAGG
GTATGCCTTCTTTGCCTCCTCGAGCTCCTTGAGCACTTGGGTGGCATCGGTGCATCCAAACATGGGCAGTTTCCACATGGTCCAGTACCTACCGTCATAG
TATCCGGGTGATCTGTGATTCTCACGGTAGACGAATCCGACCTTGCTGAACTCCAAGCAAGGCACCCACTTAGATCGGAGCAGGTACTCGATCTGCTTCA
AAAGGTCCTCCACTGTCAATGGCGGCAAGTACGACAGAGTCTCGAACTTCTTAATGCCCTCAATCGGCCACACCTGATTGAATGAATTGATGCAGATAAT
AGAATCGGGCCAACATTAAATATATATGAACAACGAGCACTTTGAAGGAGAAATTGAAACGTATCGTTTCTGATACCTGCATGCATCTGATCCTTCCGCC
ATTGCTGACGTTGCCAAAGCTCGAGCTGCTGGAGCGGCGGTTCACCGGGAGGCCCGCAGTGGACTTGAGCCCCTGGAAGGGAGCCACGGAGGTGGCCGAG
GAGGCCATCACGGTGGGGGCCATAGCCACGTAGTTAGTTAGCTAGCTTACTGGCTAGTAGTAGTAGAGTATGTCCAGTAGCAGTGCTGTTGAGGCCCTGT
ACGCTGGTTCACCAGCAGCTTATATAAACAGCAATCGTATCATGTCATTTCATCCATG