Detailed information on CNT30117982


BLAST search results

BLAST vs Swiss-Prot:
sp|P18566|RBS2_ORYSJ, E-value = 8e-92

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30604902Oryza nivaraOryza punctata14.1939.0894.49127forward

Expression of CNT30117982

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MHLILPPLLTLPKPELVERRLTGRPAVAEEAITVGAIAT*

>peptide 2 (92 aa)
DGFRYALGIILHEYVCIAGDLAFTCPVSPSPNDRPIVVVVLLQQRQVGARENNYVQLNTDTQKKKRKRKNMHEGTKALSCRLTPRNPVAYTR*

Sequence

>CNT30117982
CGACGGATTCAGATATGCTCTAGGCATCATATTACATGAGTACGTGTGTATAGCCGGAGATCTTGCATTCACGTGCCCTGTCTCACCGTCACCGAACGAT
AGACCGATAGTTGTAGTAGTACTCTTGCAACAACGGCAGGTCGGAGCGCGAGAGAACAATTACGTGCAGCTTAACACGGACACACAAAAAAAAAAAAGAA
AAAGAAAGAACATGCACGAAGGAACGAAAGCGCTTAGTTGCCGCCTGACTCCTCGCAACCCGGTGGCTTATACGCGATGAAGCTAATCAACTGCACCTGC
CTGACGTTGTCGAAGCCGATGATACGGACAAAGGCATCGGGGTAGGCCTTCTTGGCCTCCTCGAGCTCCTTGAGCACCTGGGTGGCATCGGTGCAGCCGA
ACATGGGCAGCTTCCACATGGTCCAATACCTGCCATCGTAGTATCCGGGAGACCTGTGGTTCTCACGGTAGACGAACCCAACCTTGCTGAACTCGAGACA
AGGCACCCACTTGGATCGAAGCAGGGTCTCGAACTTCTTGATGCCCTCAATTGGCCACACCTGAATAAATAATGTAAAAATTTAAATCAGGTTAATTTGA
ATTTCGTAACATGAGTTAATTTGATCCTTGACTTTAAAGGAGAAGCCTGAGGAGGTATATATCATATATACCTGCATGCACTTGATCCTTCCGCCATTGC
TGACGTTGCCGAAGCCCGAGTTGGTGGAGCGGCGGCTGACGGGGAGGCCGGCGGTGGCCGAGGAGGCCATCACGGTGGGGGCCATAGCCACGTAGTTAGT
TAGCTAGCTTACTGGCTAGTAGTAGTAGAGTATGTCCAGTAGCAGTGCTGTTGAGGCCCTGTACGCTGGTTCACCAGCAGCTTATATAAACAGCA