Detailed information on CNT30117979


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697886Oryza nivaraOryza sativa73.4141.8194.35301forward
CNT30597173Oryza nivaraOryza meridionalis99.2780.5999.75407forward
CNT30371519Oryza nivaraOryza glumipatula93.4110099.22383forward
CNT30104637Oryza nivaraOryza rufipogon97.3267.8699.25399forward
CNT30578440Oryza nivaraOryza barthii10069.7399.51410forward

Expression of CNT30117979

Peptides detected in this lncRNA

>peptide 1 (34 aa)
PASFLSASRICSSSSFSALSPAHRYPAAAGGDGC*

>peptide 2 (50 aa)
MIQEKEIQPCEYVTSIINLAYIYSKYLRACSPVTISLHVVNISIISLPDM*

>peptide 3 (78 aa)
LLLPFSLPRGFAPHRLSPRSRRLTATRRPPAEMDASWIHREPFSPRLSLQPTASDDPRRRSISGGLLCSPVGSFSSVL*

>peptide 4 (80 aa)
SCFLSLCLADLLLIVFLRALAGSPLPGGRRRRWMLVGFTGSHSVRGSPFSQRQATIHGGEVFQAACSAPLLEVSVLFYED*

Sequence

>CNT30117979
CTCCTGCTTCCTTTCTCTCTGCCTCGCGGATTTGCTCCTCATCGTCTTTCTCCGCGCTCTCGCCGGCTCACCGCTACCCGGCGGCCGCCGGCGGAGATGG
ATGCTAGTTGGATTCACCGGGAGCCATTCAGTCCGCGGCTCTCCCTTCAGCCAACGGCAAGCGACGATCCACGGCGGCGAAGTATTTCAGGCGGCCTGCT
CTGCTCCCCTGTTGGAAGTTTCAGTTCTGTTTTATGAAGATTAGAAATTTCAGTTTATGATCCAGGAAAAGGAAATCCAGCCATGTGAGTATGTGACTTC
AATTATAAATTTAGCTTATATTTATTCGAAATATCTGAGGGCATGCTCACCAGTCACTATTTCACTTCATGTTGTGAACATCAGTATTATCAGTCTACCA
GATATGTAAG