Detailed information on CNT30117968


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697509Oryza nivaraOryza sativa42.9375.7486.27437forward
CNT30111180Oryza nivaraOryza longistaminata13.6538.7294.24139forward

Expression of CNT30117968

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MDVLQYCVVFSSLLCSEQPVGDDVHSQAILLLLRSVHLR*

>peptide 2 (51 aa)
GPGLGEGGTLHPSLLVPEQGHACFDSNGTQSIVPIGWPAVTGMFYSIENTA*

>peptide 3 (40 aa)
AGLAWEKVGRYIPRYWSLNRDMLALTPMERNQLFQSAGRQ*

>peptide 4 (74 aa)
MSNNKTSAVSSSAAGIMSRSLLQSSTTTDDEHVTEMLLHWLLLPACTSAACRSLLLLGLWQWLSVLICDASTTT*

>peptide 5 (58 aa)
MLAVVDNRVHDGVIAIVAVGVVQVFSLLHRLCCLALLFLPVGASVVAPAQFRLMQIYN*

>peptide 6 (36 aa)
MYSSTVSFLVRCCVLSSQLATTYTVKPFCCCFVLST*

Sequence

>CNT30117968
GCGGGCCTGGCCTGGGAGAAGGTGGGACGTTACATCCCTCGTTACTGGTCCCTGAACAGGGACATGCTTGCTTTGACTCCAATGGAACGCAATCAATTGT
TCCAATCGGCTGGCCGGCAGTAACTGGGATGTTTTACTCCATCGAAAACACGGCGTGACCGTGCGAGTCAAGAAGGAATACAGCCCTTCTGTTCATTTTG
ACAGCAGCTCGGATGGATGTACTCCAGTACTGTGTCGTTTTTAGTTCGCTGTTGTGTTCTGAGCAGCCAGTTGGCGACGACGTACACAGTCAAGCCATTC
TGCTGCTGCTTCGTTCTGTCCACCTAAGGTAAAACCATAATGGAGCTGATTTGAAAAGAAAACTACTGACGACGAGGATGGATAGATGGATCAACTTTAA
AAATAAATGAGATGTGCGTGAAACATCTCGTTCTTTTGGTGATGTCCTGAAACGAGGTTGGCGCAGGTGCACGTACACACCACACATGTGATTCAGTGTG
ACTTCTTGAAAAACGGATTCAACAAAGAGTGCTAGTCATGTCGAACAACAAGACATCAGCGGTCAGTTCATCAGCAGCTGGCATCATGTCAAGAAGCTTA
TTGCAATCCTCAACGACGACTGATGATGAACATGTGACGGAGATGTTGCTGCACTGGCTGCTGTTACCGGCGTGTACTTCCGCAGCCTGCAGATCGCTGC
TGCTGCTCGGACTCTGGCAATGGCTGTCGGTGCTAATCTGTGATGCTTCGACGACGACATGATCATCAGCTAATGCCGCAGGGCCCTTGCAGCAGGTATG
CTGGCCGTAGTAGACAACCGTGTACATGATGGGGTGATCGCCATTGTAGCTGTTGGCGTGGTGCAGGTCTTCTCGCTGCTGCACCGTCTTTGTTGCCTTG
CACTTCTCTTCCTGCCTGTAGGTGCATCTGTAGTAGCTCCTGCTCAATTCAGATTGATGCAGATATATAATTAGTTGGTGTTTATACTGATTAGATCTTG
ATAACACGATTAATCAAG