Detailed information on CNT30117952


BLAST search results

BLAST vs Swiss-Prot:
sp|P10707|CB2D_SOLLC, E-value = 1e-22

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697144Oryza nivaraOryza sativa65.89100.8696.95819forward
CNT30184672Oryza nivaraSecale cereale11.1842.1293.53139forward
CNT30297056Oryza nivaraTriticum aestivum13.5249.1292.86168forward
CNT30390869Oryza nivaraTriticum turgidum13.1134.6894.48163forward
CNT30555350Oryza nivaraOryza glaberrima35.4877.37100441forward
CNT30438779Oryza nivaraAegilops tauschii13.5226.6292.86168forward
CNT30249379Oryza nivaraAvena sativa17.354.1692.56215forward
CNT30664041Oryza nivaraTriticum dicoccoides13.5244.895.83168forward
CNT30135675Oryza nivaraLolium perenne13.5244.3390.48168forward
CNT30597100Oryza nivaraOryza meridionalis37.0962.7296.96461forward
CNT30371256Oryza nivaraOryza glumipatula84.7996.2699.051054forward
CNT30322408Oryza nivaraAsparagus officinalis14.420.682.68179forward
CNT30151052Oryza nivaraBrachypodium distachyon9.0948.7192.04113forward
CNT30104243Oryza nivaraOryza rufipogon43.0499.0799.44535forward
CNT30578138Oryza nivaraOryza barthii67.82100.4898.93843forward
CNT3039554Oryza nivaraMarchantia polymorpha7.8826.7893.8898forward

Expression of CNT30117952

Peptides detected in this lncRNA

>peptide 1 (79 aa)
GKPFSNVNDDENHFETIYSGSKYFSATNPNTWSFLSEDQNEQVFKFISQLDDNLHVHLTHSSTLLKLLPSSSRVRLKLT*

>peptide 2 (58 aa)
QGNHSAMSTMMKTTSRQFTQVANISQPQIQTLGPSYQKIRMNRFSNSSPNSTIIYTYI*

>peptide 3 (68 aa)
MKNPSMENMASRPFLISFTFSSAAWSGSLASPSGSNGPPGWSLSSRSCTTIAIAGESPVSISEQNQQV*

>peptide 4 (44 aa)
MGRAPPSPQAHNSEGGGRCSRRGGAVFRKGESVVGVCGGKGELV*

>peptide 5 (37 aa)
MQQKRWCCVQKGGECGGRLWRERRASLNGWKWGFGGCC

Sequence

>CNT30117952
CAGGGAAACCATTCAGCAATGTCAACGATGATGAAAACCACTTCGAGACAATTTACTCAGGTAGCAAATATTTCTCAGCCACAAATCCAAACACTTGGTC
CTTCCTATCAGAAGATCAGAATGAACAGGTTTTCAAATTCATCTCCCAACTCGACGATAATTTACACGTACATTTAACACATTCTTCCACCCTTCTCAAA
CTCCTCCCTTCTTCTTCCCGGGTAAGATTAAAATTAACTTGAGGCCAGCCAGCGTCGCCGGCGGCGAGATGTTTACAGGCTGGGCGTCCTCTCGGCGGCG
CCGGAGATGACGGTGAGCAGGTTGTTCTCGACGGGGCCCTCGCCGGTGACGTAGGCCTGGATGAAGAACCCCAGCATGGAGAACATGGCCAGCCGCCCGT
TCTTGATCTCCTTCACCTTCAGCAGCGCCGCCTGGTCCGGGTCGCTCGCCAGCCCCAGCGGGTCGAATGGGCCACCTGGGTGGAGCTTGTCCTCCAGATC
CTGCACCACCATCGCCATCGCCGGCGAATCTCCGGTGAGTATCAGCGAGCAAAATCAACAAGTGTAGACTAACTAAGGTCCCGTGTTTGAGTTCATCGAA
GATAAATTAAGGGTACTTCAAATGAGAAAGCTATTAGCGTTTGATTAATTGAGTTCTAATTACTTTAAGTTTGAAAGAGGATTTAAAATTTTTATATAAA
AAGTTCTTGTACGAAATACACCATTCAACAAATTGGAAAGTGTGCTACCGGAAACAAAAAAAAATGTAAGACTAATTAAGTTTTAATTATTTTAGATTTG
GAAAAGGATCTATTTGATATTTTAAAGCAATTTTGATATACAAAGTTTTCGTACGAGATATAGCATTTAACAAATTGGAAAGCGTGCTACCGGAAACCAA
AAGGTGTAAGACTAGGGCGTGTAGATTGTGCAGTTGACTGACCAGGCCGTTGATGATCCGGTAGTACTCGGCGCCGCCGACGAGGACGACCTCGGCGGCG
ACGGCGACGATGAGGTTGATGGGGATGCTGTTGCCGAAGTAGTTGAGGGAGTTGAGCCGGGTGCCGAGCATCTTGGATGGGGCGAGCGCCGCCATCGCCT
CAGGCCCACAATTCAGAGGGAGGTGGGAGATGCAGCAGAAGAGGTGGTGCTGTGTTCAGAAAGGGGGAGAGTGTGGTGGGCGTTTGTGGAGGGAAAGGAG
AGCTAGTTTAAATGGATGGAAATGGGGATTTGGAGGATGTTGT