Detailed information on CNT30117926


BLAST search results

BLAST vs Swiss-Prot:
sp|P0C5B3|MT1A_ORYSJ, E-value = 4e-19

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555477Oryza nivaraOryza glaberrima10078.7999.21509forward
CNT30107782Oryza nivaraOryza longistaminata77.2185.8195.42393forward
CNT30104275Oryza nivaraOryza rufipogon99.6169.1799.41507forward
CNT30578098Oryza nivaraOryza barthii97.4585.0898.79496forward

Expression of CNT30117926

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MVDAGRHLNSCKGCTCSWNRSCSHGRSRRTLRPPQTAAPSSPAPHPARRWPWCCCSSLPGAV*

>peptide 2 (96 aa)
MQAGILTVARVAPAAGTAAAAMGGLAGLCGRLKLLRLLLRRHTQHDGGLGAAALLFQEQFEPQLQLDPQLQDIFSQSVIKLKQLKMKSTKEKKKSF*

Sequence

>CNT30117926
TAGCCAAACCAGTTTAATATATTCATCACTTCATCTGTGGATACACCATTACAAGCATAGTACGTGAATAGTGAAACCAATAACATAGCACATCGATTAA
CCCATCACACACACACACACACACCATATATATTGGTCAAGCACCAACCCAAATGGCCAAGCTTCTTTATTTTTCTGCATCACAATTCACACGCACACAT
GATAGATGGTAGATGCAGGCAGGCATCTTAACAGTTGCAAGGGTTGCACCTGCAGCTGGAACCGCAGCTGCAGCCATGGGCGGTCTCGCCGGACTCTGCG
GCCGCCTCAAACTGCTGCGCCTTCTTCTCCGGCGCCACACCCAGCACGACGGTGGCCTTGGTGCTGCTGCTCTTCTCTTCCAGGAGCAGTTTGAGCCGCA
GCTGCAGCTAGATCCACAGCTGCAAGACATCTTCTCTCAGTCTGTAATTAAGCTCAAGCAACTGAAGATGAAATCAACTAAGGAGAAGAAGAAGAGCTTT
TGAGATGAT