Detailed information on CNT30117920


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30109981Oryza nivaraOryza longistaminata60.6889.4694.37764forward
CNT30604576Oryza nivaraOryza punctata11.620.6884.93146forward

Expression of CNT30117920

Peptides detected in this lncRNA

>peptide 1 (74 aa)
SDSPVALAAAPPALCRRRCCSSLHRRRRWCSRRRSPQSSSSVAGRWKEGEKAEKNRKEGKKGKFDRRREIWGIW*

>peptide 2 (46 aa)
MLLIRVSTHIQIHDVIHVSLFRMFCLHYSRTMRSHGSAIWIFIHDP*

>peptide 3 (38 aa)
MMVWIVWFISVLTFLITACRDVRIFRGDSTKISNNFRT*

>peptide 4 (64 aa)
ERFSCSPSRRTSCALPPPLLFLSSPAPPLVQPSPVATVVVVRSRSLEGGREGREEQEGRKEGEI*

>peptide 5 (35 aa)
MLRGYSHLPGRELLSFDFFGLKIKYLMTSIGMGRE*

>peptide 6 (54 aa)
MAMTLCYLFVFRPIFKFMTLFMFHYSGCSVYIIQEPCVAMGVQFGSLFMILEKR*

Sequence

>CNT30117920
GAGCGATTCTCCTGTAGCCCTAGCCGCCGCACCTCCTGCGCTCTGCCGCCGCCGCTGCTGTTCCTCTCTTCACCGGCGCCGCCGCTGGTGCAGCCGTCGC
CGGTCGCCACAGTCGTCGTCGTCCGTAGCCGGTCGTTGGAAGGAGGGAGAGAAGGCAGAGAAGAACAGGAAGGAAGGAAAGAAGGGGAAATTTGATAGAA
GAAGGGAAATTTGGGGAATTTGGTGAATATTTCCAAATTCTTCGTTTTTCTTATACATTAGTACTGCTAGGTGTGGAGGGTTCCAACGTTGGAGGAGTTG
AGTCGGAGTATCGAATGAGTTAAGGCAAGTACAAGACGGACTTATGTGATGGACAAAACTGAGTTGTTTTGTTTGGCTTTACTTGCATAATTATTATTCA
ATTGCTTGTTATTACTGATTGTATGGCTATGACGTTATGCTACTTATTCGTGTTTCGACCCATATTCAAATTCATGACGTTATTCATGTTTCATTATTCC
GGATGTTCTGTTTACATTATTCAAGAACCATGCGTAGCCATGGGAGTGCAATTTGGATCTTTATTCATGATCCTTGAGAAGCGCTGATCACGCTTGCTCG
GCTTACCGGTAATGCTAAGAGGATATTCACACCTGCCCGGGAGGGAACTACTATCTTTTGACTTCTTTGGTTTAAAAATAAAGTACCTAATGACATCGAT
CGGCATGGGGCGGGAGTAGCACCCTTGGACTACACATTATTATTGCACACAATTGAAATTAGTTTTAGACTATAATTTTTGCTCAGCATAAGTTTTGCAT
AGAACTTGTAAAGGTCATTTAAGGTTCTGATTCTTATTTTTCACGTGGGATTTGTGGAGCTATGATGGTTTGGATTGTGTGGTTTATATCGGTATTGACC
TTTCTTATAACTGCCTGTCGTGATGTCCGTATTTTTAGGGGAGACTCTACCAAAATTTCTAATAATTTTAGGACTTAGTTTTTGAGTGTATTTTGGTGTG
GCATTCTAGGTACGTGGTTACCTGGGGTGTTACATCTTATGTGAGTTTGGTTCGTGGCTTTAGGCTACCTACCTCATGTATAAATAGAGAGGGAGCGTGA
GGCCTCCCGGTATCGTTTTTGAGAGTATTGAGTTGTAAGTTTAGTTAGGGTTTCGAGTTTAGTCGAGATTTTCGTGAGGAGTGCTATTGTTGAACTTTTT
AAACAGATACTTGGATTACCAAATTTGGTCATTAACAAACACAGAGAGAAGTAATAAAG